Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10629
Gene name
LocationContig_88:6409..7757
Strand+
Gene length (bp)1348
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01758 SBF Sodium Bile acid symporter family 6.2E-53 85 280

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8NQC8|ACR3_CORGL Arsenical-resistance protein Acr3 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=acr3 PE=1 SV=2 22 374 9.0E-100
sp|P45946|ARSB_BACSU Arsenite resistance protein ArsB OS=Bacillus subtilis (strain 168) GN=arsB PE=3 SV=2 38 375 2.0E-95
sp|Q06598|ARR3_YEAST Arsenical-resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARR3 PE=1 SV=1 64 378 1.0E-74
sp|P74311|Y944_SYNY3 Uncharacterized transporter slr0944 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0944 PE=3 SV=1 30 369 8.0E-49
sp|A6TP80|ACR3_ALKMQ Arsenical-resistance protein Acr3 OS=Alkaliphilus metalliredigens (strain QYMF) GN=acr3 PE=1 SV=1 38 350 7.0E-39

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 46 65 19
2 75 97 22
3 117 139 22
4 149 171 22
5 178 200 22
6 215 237 22
7 250 272 22
8 285 307 22
9 314 336 22
10 346 368 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10629
MHATTPPAPTEHNGNGQPDPENQTTDRSKGPVSVSAFRHLGFLDRYLAVWIFLAMAIGIILGNFVPETGPSLQKG
KFVGVSAPIAVGLLVMMYPILCKVRYESLHELLSQRGMWKQICFSLVVNWILAPFLMLGLAWAFLPDRSDLRIGL
ILVGVGRCIAMVLVWNGLAGGDDEYCAILVAINSLLQTVLFAPVAVFFIGTISGESGSLDISYQVVATSVAVFLG
IPLGAAVVTRLVLRAVAGHPWYQGVFLPFVSPWSLIGLLYTILVLFASQGRQVAHQVVSVLRVAAPLLVYFVLVF
VVTLWAGRILGFRFSLMVTQGFTAASNNFELAIAVAVATFGPDSDQALASTVGPLIEVPVLVGLVYTVRWLANRW
NWK*
Coding >Hirsu2|10629
ATGCACGCCACGACACCTCCGGCTCCAACGGAGCACAATGGCAACGGTCAACCAGACCCCGAGAACCAGACCACC
GATCGCAGCAAGGGCCCTGTGTCAGTATCTGCATTCAGGCACCTGGGCTTTCTCGACCGTTACCTCGCAGTCTGG
ATCTTCTTGGCGATGGCCATCGGCATCATTCTCGGTAATTTTGTCCCGGAGACGGGCCCATCCTTGCAGAAGGGC
AAATTTGTGGGTGTTTCGGCGCCAATTGCTGTCGGTTTGCTCGTCATGATGTACCCCATTCTTTGCAAGGTCCGC
TACGAATCGCTGCACGAACTCCTGTCGCAAAGGGGGATGTGGAAGCAGATTTGCTTCAGCCTGGTTGTCAACTGG
ATTCTTGCGCCCTTTCTCATGCTTGGCCTCGCCTGGGCTTTCCTCCCAGACAGGAGCGATCTTCGCATCGGCCTC
ATCCTCGTCGGAGTCGGGAGATGTATTGCCATGGTTCTTGTCTGGAATGGCCTTGCCGGCGGAGACGACGAGTAT
TGCGCCATTCTCGTCGCCATCAACTCGCTGCTGCAAACGGTCCTCTTCGCGCCGGTTGCCGTCTTCTTCATCGGC
ACCATCAGCGGGGAGTCAGGCTCCCTCGACATCTCCTACCAAGTTGTGGCCACCAGCGTGGCCGTCTTTCTCGGC
ATCCCGCTCGGAGCCGCCGTCGTGACGAGACTTGTACTCCGAGCGGTGGCTGGGCATCCCTGGTACCAGGGCGTC
TTCCTCCCATTCGTCTCGCCCTGGTCCCTCATTGGCCTGCTATATACCATTCTTGTCCTCTTCGCCTCCCAAGGT
CGCCAGGTCGCCCACCAAGTCGTGTCCGTGCTCCGTGTCGCTGCACCGCTCCTGGTGTATTTCGTCCTTGTCTTC
GTCGTTACCCTCTGGGCCGGCCGAATACTTGGCTTCAGGTTCTCTCTCATGGTCACGCAAGGTTTCACCGCCGCC
AGCAACAACTTCGAGCTTGCTATTGCCGTTGCCGTGGCCACATTCGGACCCGACAGCGATCAGGCATTGGCATCT
ACCGTCGGCCCGCTCATTGAGGTGCCCGTCCTAGTTGGCTTGGTATATACAGTTCGATGGCTGGCCAACAGGTGG
AACTGGAAGTGA
Transcript >Hirsu2|10629
ATGCACGCCACGACACCTCCGGCTCCAACGGAGCACAATGGCAACGGTCAACCAGACCCCGAGAACCAGACCACC
GATCGCAGCAAGGGCCCTGTGTCAGTATCTGCATTCAGGCACCTGGGCTTTCTCGACCGTTACCTCGCAGTCTGG
ATCTTCTTGGCGATGGCCATCGGCATCATTCTCGGTAATTTTGTCCCGGAGACGGGCCCATCCTTGCAGAAGGGC
AAATTTGTGGGTGTTTCGGCGCCAATTGCTGTCGGTTTGCTCGTCATGATGTACCCCATTCTTTGCAAGGTCCGC
TACGAATCGCTGCACGAACTCCTGTCGCAAAGGGGGATGTGGAAGCAGATTTGCTTCAGCCTGGTTGTCAACTGG
ATTCTTGCGCCCTTTCTCATGCTTGGCCTCGCCTGGGCTTTCCTCCCAGACAGGAGCGATCTTCGCATCGGCCTC
ATCCTCGTCGGAGTCGGGAGATGTATTGCCATGGTTCTTGTCTGGAATGGCCTTGCCGGCGGAGACGACGAGTAT
TGCGCCATTCTCGTCGCCATCAACTCGCTGCTGCAAACGGTCCTCTTCGCGCCGGTTGCCGTCTTCTTCATCGGC
ACCATCAGCGGGGAGTCAGGCTCCCTCGACATCTCCTACCAAGTTGTGGCCACCAGCGTGGCCGTCTTTCTCGGC
ATCCCGCTCGGAGCCGCCGTCGTGACGAGACTTGTACTCCGAGCGGTGGCTGGGCATCCCTGGTACCAGGGCGTC
TTCCTCCCATTCGTCTCGCCCTGGTCCCTCATTGGCCTGCTATATACCATTCTTGTCCTCTTCGCCTCCCAAGGT
CGCCAGGTCGCCCACCAAGTCGTGTCCGTGCTCCGTGTCGCTGCACCGCTCCTGGTGTATTTCGTCCTTGTCTTC
GTCGTTACCCTCTGGGCCGGCCGAATACTTGGCTTCAGGTTCTCTCTCATGGTCACGCAAGGTTTCACCGCCGCC
AGCAACAACTTCGAGCTTGCTATTGCCGTTGCCGTGGCCACATTCGGACCCGACAGCGATCAGGCATTGGCATCT
ACCGTCGGCCCGCTCATTGAGGTGCCCGTCCTAGTTGGCTTGGTATATACAGTTCGATGGCTGGCCAACAGGTGG
AACTGGAAGTGA
Gene >Hirsu2|10629
ATGCACGCCACGACACCTCCGGCTCCAACGGAGCACAATGGCAACGGTCAACCAGACCCCGAGAACCAGACCACC
GATCGCAGCAAGGGCCCTGTGTCAGTATCTGCATTCAGGCACCTGGGCTTTCTCGACCGTTACCTCGCAGTCTGG
ATCTTCTTGGCGATGGCCATCGGCATCATTCTCGGTAATTTTGTCCCGGAGACGGGCCCATCCTTGCAGAAGGGC
AAATTTGTGGGTGTTTCGGCGCCAATTGGTATGTCCATGTCTCGACGTCGGCTGGCAAACTCGAACGGGGGGCAG
GACCTCGGGCTGATAGAAGCGTTCTTTCATTGACGCCAGCTGTCGGTTTGCTCGTCATGATGTACCCCATTCTTT
GCAAGGTCCGCTACGAATCGCTGCACGAACTCCTGTCGCAAAGGGGGATGTGGAAGCAGATTTGCTTCAGCCTGG
TTGTCAACTGGATTCTTGCGCCCTTTCTCATGGTAAGTCTGTAGGGAGAACGGTGAGGAGACAACAGTCACGGCC
AACCTTTTCTGCACCAGCTTGGCCTCGCCTGGGCTTTCCTCCCAGACAGGAGCGATCTTCGCATCGGCCTCATCC
TCGTCGGAGTCGGGAGATGTATTGCCATGGTCAGGACGCTTTCTCCCTCCCGAGCCCCTTTAAGTGGTCGATGCT
GACACGGTTGCTCCCACAGGTTCTTGTCTGGAATGGCCTTGCCGGCGGAGACGACGAGTATTGCGCCATTCTCGT
CGCCATCAACTCGCTGCTGCAAACGGTCCTCTTCGCGCCGGTTGCCGTCTTCTTCATCGGCACCATCAGCGGGGA
GTCAGGCTCCCTCGACATCTCCTACCAAGTTGTGGCCACCAGCGTGGCCGTCTTTCTCGGCATCCCGCTCGGAGC
CGCCGTCGTGACGAGACTTGTACTCCGAGCGGTGGCTGGGCATCCCTGGTACCAGGGCGTCTTCCTCCCATTCGT
CTCGCCCTGGTCCCTCATTGGCCTGCTATATACCATTCTTGTCCTCTTCGCCTCCCAAGGTCGCCAGGTCGCCCA
CCAAGTCGTGTCCGTGCTCCGTGTCGCTGCACCGCTCCTGGTGTATTTCGTCCTTGTCTTCGTCGTTACCCTCTG
GGCCGGCCGAATACTTGGCTTCAGGTTCTCTCTCATGGTCACGCAAGGTTTCACCGCCGCCAGCAACAACTTCGA
GCTTGCTATTGCCGTTGCCGTGGCCACATTCGGACCCGACAGCGATCAGGCATTGGCATCTACCGTCGGCCCGCT
CATTGAGGTGCCCGTCCTAGTTGGCTTGGTATATACAGTTCGATGGCTGGCCAACAGGTGGAACTGGAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail