Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10628
Gene name
LocationContig_88:2719..4705
Strand+
Gene length (bp)1986
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.8E-25 63 444
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-08 360 550
PF00083 Sugar_tr Sugar (and other) transporter 3.4E-19 85 530

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 20 505 8.0E-72
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 36 505 2.0E-19
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 40 561 1.0E-18
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 40 561 1.0E-18
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 40 561 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 20 505 8.0E-72
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 36 505 2.0E-19
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 40 561 1.0E-18
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 40 561 1.0E-18
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 40 561 2.0E-18
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 40 507 1.0E-17
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 41 504 3.0E-16
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 49 290 3.0E-16
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 49 292 3.0E-16
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 49 292 3.0E-16
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 49 292 3.0E-16
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 49 292 4.0E-16
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 51 292 1.0E-15
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 49 390 2.0E-15
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 49 390 4.0E-15
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 40 561 4.0E-15
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 49 390 7.0E-15
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 40 561 2.0E-14
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 46 372 9.0E-14
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 46 372 6.0E-13
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 46 205 1.0E-12
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 42 538 9.0E-11
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 39 295 6.0E-10
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 95 561 7.0E-10
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 60 204 1.0E-09
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 102 562 8.0E-09
sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter PcaK OS=Pseudomonas putida GN=pcaK PE=1 SV=1 41 181 4.0E-08
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 103 554 1.0E-07
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 95 553 5.0E-07
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 41 181 5.0E-07
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 52 557 9.0E-07
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 46 559 9.0E-07
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 43 563 2.0E-06
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 52 562 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 93 115 22
3 122 144 22
4 148 170 22
5 179 201 22
6 239 261 22
7 355 377 22
8 397 419 22
9 426 445 19
10 455 474 19
11 487 509 22
12 524 546 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10628
MTNKLFAAVSASSGPDRFHRRDIDLSGLDCLSLYEKKCALVNREFDAQGMGRYQWYIWFLCGFGYFLDLLWAQAF
GLVLSPLQQELGFSNRQSGNISTSFNAGLTAGAFFWGFMSDIVGRRWAFNLTCLLSSVFGLCLGAANSYNTFLVL
TAFVGFGVGGNIPVDGAIFLEFVPQKKRFLLACLSVFQPAGVIVCSAIAFAFIPKNSCSPNFSEPSPLPSCRNVA
SGIACCSRSDNMGWRYLLYTLGALTLFVFFMRTLVFKCKETPKFLIYRGHDARAIETLEYVSRINKQECQLTLDV
FNGLQAQYDSERGHSELSPLRDDKRRHSSARYRRKLLSELDRFKILFNTPKMTTLTILTWLTYILDFSGFTIAGF
YLPRILALKNGQASISLEHTYASYIYCYAPGIAAVLLGAYLSQVPAIGQKWTMVASSALMGTSIFLLSQVDSRAK
NEGFFILEYFFQSTFNAVLYAWTPQAFPAPIRGTACGVASFWGRLFGIVSPLIAQYLYGRAEDAGGRGDVNSVLY
LAGGVTLGCVLTLALLPTSVVNSEDEQAEAHDAHRSEP*
Coding >Hirsu2|10628
ATGACCAACAAGCTCTTCGCCGCGGTGTCGGCCTCGTCCGGCCCTGACAGGTTTCATCGGCGAGACATTGACCTG
TCCGGGCTAGACTGTCTCTCCCTGTACGAGAAGAAGTGCGCGCTCGTGAACCGCGAATTCGATGCCCAGGGCATG
GGGAGATACCAGTGGTACATCTGGTTCCTCTGCGGTTTCGGATACTTCCTCGACCTGCTGTGGGCGCAGGCGTTC
GGCCTCGTGCTTAGCCCCCTGCAGCAGGAGCTCGGCTTCTCCAACAGGCAGTCGGGCAACATCTCGACCAGCTTC
AACGCCGGTCTGACGGCCGGCGCCTTCTTCTGGGGCTTCATGTCGGACATCGTGGGTCGTCGCTGGGCCTTCAAC
CTGACCTGCCTCCTCTCCTCCGTCTTCGGCCTGTGCCTCGGCGCCGCCAACAGCTACAACACCTTCCTCGTCCTG
ACCGCCTTCGTTGGCTTCGGCGTGGGCGGCAACATCCCCGTCGACGGGGCCATCTTCCTCGAATTCGTCCCGCAA
AAAAAACGCTTCCTGCTGGCCTGCCTGTCCGTCTTCCAGCCGGCGGGCGTCATCGTGTGCAGCGCCATCGCCTTC
GCCTTCATCCCGAAGAACTCGTGCTCGCCCAACTTCTCCGAGCCGAGCCCGCTGCCGTCCTGCCGCAATGTCGCC
TCGGGCATCGCCTGCTGCTCCCGGTCCGACAACATGGGCTGGCGCTATCTCCTCTACACCCTCGGCGCCCTGACT
CTCTTCGTCTTCTTCATGCGCACCCTGGTCTTCAAGTGCAAGGAGACGCCCAAGTTCCTCATCTACCGCGGACAC
GATGCCCGGGCCATCGAGACGCTGGAATACGTCTCTCGGATCAACAAGCAGGAGTGCCAGCTGACGCTCGACGTC
TTCAACGGCCTACAGGCCCAATACGACTCGGAGCGAGGCCATTCCGAGTTGAGCCCGCTGCGCGACGATAAACGG
CGGCATTCGTCGGCCAGGTACCGCCGGAAGCTCCTTTCCGAGCTGGACAGATTCAAAATCCTCTTCAACACGCCC
AAGATGACCACTCTGACGATACTGACCTGGCTGACCTACATCTTGGATTTCAGTGGCTTCACCATTGCCGGATTC
TACCTCCCCCGGATACTGGCGCTGAAGAACGGACAGGCCTCGATCAGCCTCGAGCACACCTACGCATCGTACATT
TACTGCTACGCCCCCGGGATCGCGGCCGTCCTGTTGGGCGCGTACTTGAGCCAAGTCCCGGCCATCGGCCAGAAG
TGGACAATGGTGGCATCGTCGGCCCTGATGGGCACCTCCATCTTCCTTCTCTCCCAGGTCGACTCGCGGGCCAAG
AACGAAGGCTTCTTCATCCTCGAATACTTCTTCCAGTCGACCTTCAACGCCGTCCTCTACGCCTGGACCCCGCAG
GCGTTCCCGGCCCCCATCCGCGGCACCGCCTGCGGCGTGGCCAGCTTCTGGGGGCGTCTGTTCGGCATCGTGAGC
CCCCTGATCGCACAGTACCTGTACGGTCGGGCAGAGGACGCGGGCGGTCGCGGGGACGTCAACAGCGTGCTGTAT
CTCGCCGGCGGCGTGACGCTGGGCTGCGTCCTGACCTTGGCTTTGCTGCCCACGTCCGTGGTCAATTCCGAAGAC
GAGCAGGCAGAGGCGCACGACGCTCATCGTTCGGAGCCGTGA
Transcript >Hirsu2|10628
ATGACCAACAAGCTCTTCGCCGCGGTGTCGGCCTCGTCCGGCCCTGACAGGTTTCATCGGCGAGACATTGACCTG
TCCGGGCTAGACTGTCTCTCCCTGTACGAGAAGAAGTGCGCGCTCGTGAACCGCGAATTCGATGCCCAGGGCATG
GGGAGATACCAGTGGTACATCTGGTTCCTCTGCGGTTTCGGATACTTCCTCGACCTGCTGTGGGCGCAGGCGTTC
GGCCTCGTGCTTAGCCCCCTGCAGCAGGAGCTCGGCTTCTCCAACAGGCAGTCGGGCAACATCTCGACCAGCTTC
AACGCCGGTCTGACGGCCGGCGCCTTCTTCTGGGGCTTCATGTCGGACATCGTGGGTCGTCGCTGGGCCTTCAAC
CTGACCTGCCTCCTCTCCTCCGTCTTCGGCCTGTGCCTCGGCGCCGCCAACAGCTACAACACCTTCCTCGTCCTG
ACCGCCTTCGTTGGCTTCGGCGTGGGCGGCAACATCCCCGTCGACGGGGCCATCTTCCTCGAATTCGTCCCGCAA
AAAAAACGCTTCCTGCTGGCCTGCCTGTCCGTCTTCCAGCCGGCGGGCGTCATCGTGTGCAGCGCCATCGCCTTC
GCCTTCATCCCGAAGAACTCGTGCTCGCCCAACTTCTCCGAGCCGAGCCCGCTGCCGTCCTGCCGCAATGTCGCC
TCGGGCATCGCCTGCTGCTCCCGGTCCGACAACATGGGCTGGCGCTATCTCCTCTACACCCTCGGCGCCCTGACT
CTCTTCGTCTTCTTCATGCGCACCCTGGTCTTCAAGTGCAAGGAGACGCCCAAGTTCCTCATCTACCGCGGACAC
GATGCCCGGGCCATCGAGACGCTGGAATACGTCTCTCGGATCAACAAGCAGGAGTGCCAGCTGACGCTCGACGTC
TTCAACGGCCTACAGGCCCAATACGACTCGGAGCGAGGCCATTCCGAGTTGAGCCCGCTGCGCGACGATAAACGG
CGGCATTCGTCGGCCAGGTACCGCCGGAAGCTCCTTTCCGAGCTGGACAGATTCAAAATCCTCTTCAACACGCCC
AAGATGACCACTCTGACGATACTGACCTGGCTGACCTACATCTTGGATTTCAGTGGCTTCACCATTGCCGGATTC
TACCTCCCCCGGATACTGGCGCTGAAGAACGGACAGGCCTCGATCAGCCTCGAGCACACCTACGCATCGTACATT
TACTGCTACGCCCCCGGGATCGCGGCCGTCCTGTTGGGCGCGTACTTGAGCCAAGTCCCGGCCATCGGCCAGAAG
TGGACAATGGTGGCATCGTCGGCCCTGATGGGCACCTCCATCTTCCTTCTCTCCCAGGTCGACTCGCGGGCCAAG
AACGAAGGCTTCTTCATCCTCGAATACTTCTTCCAGTCGACCTTCAACGCCGTCCTCTACGCCTGGACCCCGCAG
GCGTTCCCGGCCCCCATCCGCGGCACCGCCTGCGGCGTGGCCAGCTTCTGGGGGCGTCTGTTCGGCATCGTGAGC
CCCCTGATCGCACAGTACCTGTACGGTCGGGCAGAGGACGCGGGCGGTCGCGGGGACGTCAACAGCGTGCTGTAT
CTCGCCGGCGGCGTGACGCTGGGCTGCGTCCTGACCTTGGCTTTGCTGCCCACGTCCGTGGTCAATTCCGAAGAC
GAGCAGGCAGAGGCGCACGACGCTCATCGTTCGGAGCCGTGA
Gene >Hirsu2|10628
ATGACCAACAAGCTCTTCGCCGCGGTGTCGGCCTCGTCCGGCCCTGACAGGTTTCATCGGCGAGACATTGACCTG
TCCGGGCTAGACTGTCTCTCCCTGTACGAGAAGAAGTGCGCGCTCGTGAACCGCGAATTCGATGCCCAGGGCATG
GGGAGATACCAGTGGTACATCTGGTTCCTCTGCGGTTTCGGATACTTCCTCGACCTGCTGTGGGCGCAGGCGTTC
GGCCTCGTGCTTAGCCCCCTGCAGCAGGAGCTCGGCTTCTCCAACAGGCAGTCGGGCAACATCTCGACCAGCTTC
AACGCCGGTCTGACGGCCGGCGCCTTCTTCTGGGGCTTCATGTCGGACATCGTGGGTAATGACCCTTCCATCCGG
CCCTCCTCCGCCTCATCTACTGGCCGCTCCAATGCCTCCTGCTCTTCCATGGTCCCCTGCCGCTGACATGCAAGC
ATCCAACTTGAACCAACACCAGGTCGTCGCTGGGCCTTCAACCTGACCTGCCTCCTCTCCTCCGTCTTCGGCCTG
TGCCTCGGCGCCGCCAACAGCTACAACACCTTCCTCGTCCTGACCGCCTTCGTTGGCTTCGGCGTGGGCGGCAAC
ATCCCCGTCGACGGGGCCATCTTCCTCGAATTCGTCCCGCAAGTCGGTCCGCCTTCTTCCCCGTACGCACAGCTC
GAGCACAACTGGACTGACCCGGCCGTTTAGAAAAAACGCTTCCTGCTGGCCTGCCTGTCCGTCTTCCAGCCGGCG
GGCGTCATCGTGTGCAGCGCCATCGCCTTCGCCTTCATCCCGAAGAACTCGTGCTCGCCCAACTTCTCCGAGCCG
AGCCCGCTGCCGTCCTGCCGCAATGTCGCCTCGGGCATCGCCTGCTGCTCCCGGTCCGACAACATGGGCTGGCGC
TATCTCCTCTACACCCTCGGCGCCCTGACTCTCTTCGTCTTCTTCATGCGCACCCTGGTCTTCAAGTGCAAGGAG
ACGCCCAAGTTCCTCATCTACCGCGGACACGATGCCCGGGCCATCGAGACGCTGGAATACGTCTCTCGGATCAAC
AAGCAGGAGTGCCAGCTGACGCTCGACGTCTTCAACGGCCTACAGGCCCAATACGACTCGGAGCGAGGCCATTCC
GAGTTGAGCCCGCTGCGCGACGATAAACGGCGGCATTCGTCGGCCAGGTACCGCCGGAAGCTCCTTTCCGAGCTG
GACAGATTCAAAATCCTCTTCAACACGCCCAAGATGACCACTCTGACGATACTGACCTGGCTGACCTACATCTTG
GATTTCAGTGGCTTCACCATTGCCGGTACGTGCATACACTTCTACTGCACCCTGCCCCGGGCTCCATGTGCCCTC
CGAAGTGTATATAAACCGTTTGTTTTTGTTCTCTGAGCTGACTCCCGTCGGTCCCGGCCTTCAGGATTCTACCTC
CCCCGGATACTGGCGCTGAAGAACGGACAGGCCTCGATCAGCCTCGAGCACACCTACGCATCGTACATTTACTGC
TACGCCCCCGGGATCGCGGCCGTCCTGTTGGGCGCGTACTTGAGCCAAGTCCCGGCCATCGGCCAGAAGTGGACA
ATGGTGGCATCGTCGGCCCTGATGGGCACCTCCATCTTCCTTCTCTCCCAGGTCGACTCGCGGGCCAAGAACGAA
GGCTTCTTCATCCTCGAATACTTCTTCCAGTCGACCTTCAACGCCGTCCTCTACGCCTGGACCCCGCAGGCGTTC
CCGGCCCCCATCCGCGGCACCGCCTGCGGCGTGGCCAGCTTCTGGGGGCGTCTGTTCGGCATCGTGAGCCCCCTG
ATCGCACAGTACCTGTACGGTCGGGCAGAGGACGCGGGCGGTCGCGGGGACGTCAACAGCGTGCTGTATCTCGCC
GGCGGCGTGACGCTGGGCTGCGTCCTGACCTTGGCTTTGCTGCCCACGTCCGTGGTCAATTCCGAAGACGAGCAG
GCAGAGGCGCACGACGCTCATCGTTCGGAGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail