Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10623
Gene name
LocationContig_879:3939..5997
Strand-
Gene length (bp)2058
Transcript length (bp)2058
Coding sequence length (bp)2058
Protein length (aa) 686

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 223 329 1.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 223 327 2.0E-07
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 230 329 9.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 80 102 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10623
MSGPPPPPPPHGEVPRSSGLPPGKYDIFVIPEHSAGAGFLYLPSMRPSPNSFAAGFASALILVALFQSMAPAFKA
WWESFQGLGNMGMTLLIIGVGFGAWALGRTQKDGPASGYRPHHPQPDRGPGSAGAGFRPATSAPPPPNPGSPPPP
PHGGNTAPPPPPPPPPPPPPQTDDDGPPPPPPPPPRREQREETPKTSWQRPPPQAGTPKPETPKPDTPKGTWEKA
REETRKKEEERKAKEAEKKRREDAARRLAELRAREAREREEREKEKARKDKEEREKKERELAEERRKKLAEDLKQ
KRAAERLEKEKREKEAQAREEQKAKAEAATETAASSSATAAEPTPGPRVGSSYAYSAVGEKTNMWPNGRPSVPSQ
AGSSPSKAGSSAGRRPPAPTARTYVSTDEDGFSYRPYDKAGRRSGRRPSMSSVGGSESSWAPSHTTARTSPPPSV
RGPYSTKDPDKIVIQAVYLFMNQFAKTPASQLVSGVGSVTDGLILRITTEGLFIDDDVRGVPQREWDVKAWTLKN
VEAWCPPHCLKSAASVASSAAAGAKSPPHLLYKMATARRNADKDKFLTGDEADAHLTEMLRACKECCRLGLCERR
FKNTTIQSPTGQTGEWRDKGLHVLRATIRDQEGKRYLFVLDETEGWKVAVGLQRLRRGTQVRQLGVAGMVPSEAR
GTLETLGWSG*
Coding >Hirsu2|10623
ATGAGTGGCCCTCCGCCTCCGCCTCCGCCCCATGGCGAGGTGCCTAGGTCCTCGGGCTTGCCGCCCGGCAAGTAC
GACATCTTCGTCATTCCCGAGCACTCGGCCGGCGCCGGCTTCCTCTACCTGCCCTCGATGCGGCCGAGTCCGAAC
AGCTTCGCCGCCGGCTTCGCCTCGGCCCTCATCCTCGTCGCCCTCTTCCAGAGCATGGCGCCCGCCTTCAAGGCC
TGGTGGGAGAGCTTCCAGGGCCTCGGCAACATGGGCATGACCCTGCTCATCATCGGCGTCGGCTTCGGCGCTTGG
GCTCTCGGTCGCACCCAAAAAGACGGCCCGGCTTCGGGCTACAGGCCTCATCATCCTCAGCCTGACCGTGGCCCT
GGCAGCGCCGGGGCCGGTTTCAGGCCCGCCACCTCGGCGCCGCCGCCACCCAACCCCGGGAGCCCTCCACCTCCG
CCACACGGCGGCAACACTGCTCCACCCCCTCCTCCCCCGCCGCCGCCGCCGCCTCCGCCGCAGACCGACGATGAC
GGCCCTCCACCTCCGCCTCCGCCACCTCCCCGGCGGGAGCAACGCGAGGAGACGCCCAAGACTTCTTGGCAGCGC
CCGCCTCCGCAAGCCGGGACGCCCAAGCCCGAGACGCCCAAGCCGGACACGCCCAAGGGGACCTGGGAAAAGGCG
CGCGAGGAGACGAGGAAAAAGGAAGAGGAGCGCAAGGCCAAGGAGGCGGAGAAGAAGCGTCGCGAGGACGCCGCC
CGAAGGCTGGCCGAACTGCGCGCCAGGGAGGCAAGAGAGAGGGAGGAGCGGGAAAAGGAAAAGGCGCGCAAAGAC
AAGGAGGAGCGAGAGAAGAAGGAGCGCGAGCTCGCCGAGGAGCGGAGGAAGAAGCTGGCCGAAGATCTGAAGCAG
AAACGAGCGGCCGAGCGGCTGGAGAAGGAGAAGCGGGAGAAGGAGGCCCAGGCGCGCGAGGAGCAAAAGGCCAAG
GCCGAGGCCGCGACGGAGACGGCCGCGTCGTCATCGGCCACTGCGGCAGAGCCGACGCCTGGCCCCCGTGTCGGC
AGCTCGTACGCCTACTCGGCCGTCGGCGAGAAGACCAACATGTGGCCCAACGGCCGGCCCTCGGTGCCGTCTCAG
GCCGGCAGCTCGCCGTCCAAGGCCGGGTCGAGCGCGGGAAGGCGACCGCCGGCGCCGACGGCCAGGACGTACGTC
AGCACGGACGAGGACGGCTTCTCGTACAGACCGTACGACAAGGCCGGCAGGAGGTCGGGGCGCAGACCGTCCATG
TCGTCGGTGGGCGGATCCGAGTCGTCGTGGGCCCCCTCGCACACGACGGCGCGGACGTCGCCGCCGCCGTCGGTG
CGCGGCCCCTACTCGACCAAGGACCCGGACAAGATCGTCATCCAGGCCGTCTACCTCTTCATGAACCAGTTCGCC
AAGACGCCGGCCAGCCAGCTCGTGTCCGGGGTCGGATCGGTGACGGACGGCCTGATCCTGCGCATCACGACCGAG
GGCCTCTTCATCGACGACGACGTGCGCGGCGTGCCGCAGCGGGAATGGGACGTCAAGGCCTGGACGCTCAAGAAC
GTCGAGGCGTGGTGCCCGCCGCACTGTCTCAAGTCGGCGGCGTCGGTGGCGTCGAGCGCGGCGGCCGGGGCCAAG
AGCCCCCCCCACCTGCTGTACAAGATGGCGACGGCCCGGCGCAACGCGGACAAGGACAAGTTCCTGACGGGCGAC
GAGGCCGACGCGCACCTGACGGAGATGCTGCGGGCGTGCAAGGAGTGCTGCCGGCTGGGCCTGTGCGAGCGGCGC
TTCAAGAACACCACCATCCAGTCGCCGACGGGCCAGACGGGCGAGTGGAGAGACAAGGGCCTGCACGTCCTCCGG
GCCACGATCCGCGACCAGGAGGGGAAGCGCTACCTCTTCGTCCTCGACGAGACGGAGGGCTGGAAGGTGGCGGTC
GGGCTGCAGCGCCTGCGCCGCGGCACACAGGTGCGGCAGCTGGGCGTCGCCGGCATGGTGCCCTCGGAGGCCCGC
GGCACCCTGGAGACGCTGGGCTGGAGCGGCTGA
Transcript >Hirsu2|10623
ATGAGTGGCCCTCCGCCTCCGCCTCCGCCCCATGGCGAGGTGCCTAGGTCCTCGGGCTTGCCGCCCGGCAAGTAC
GACATCTTCGTCATTCCCGAGCACTCGGCCGGCGCCGGCTTCCTCTACCTGCCCTCGATGCGGCCGAGTCCGAAC
AGCTTCGCCGCCGGCTTCGCCTCGGCCCTCATCCTCGTCGCCCTCTTCCAGAGCATGGCGCCCGCCTTCAAGGCC
TGGTGGGAGAGCTTCCAGGGCCTCGGCAACATGGGCATGACCCTGCTCATCATCGGCGTCGGCTTCGGCGCTTGG
GCTCTCGGTCGCACCCAAAAAGACGGCCCGGCTTCGGGCTACAGGCCTCATCATCCTCAGCCTGACCGTGGCCCT
GGCAGCGCCGGGGCCGGTTTCAGGCCCGCCACCTCGGCGCCGCCGCCACCCAACCCCGGGAGCCCTCCACCTCCG
CCACACGGCGGCAACACTGCTCCACCCCCTCCTCCCCCGCCGCCGCCGCCGCCTCCGCCGCAGACCGACGATGAC
GGCCCTCCACCTCCGCCTCCGCCACCTCCCCGGCGGGAGCAACGCGAGGAGACGCCCAAGACTTCTTGGCAGCGC
CCGCCTCCGCAAGCCGGGACGCCCAAGCCCGAGACGCCCAAGCCGGACACGCCCAAGGGGACCTGGGAAAAGGCG
CGCGAGGAGACGAGGAAAAAGGAAGAGGAGCGCAAGGCCAAGGAGGCGGAGAAGAAGCGTCGCGAGGACGCCGCC
CGAAGGCTGGCCGAACTGCGCGCCAGGGAGGCAAGAGAGAGGGAGGAGCGGGAAAAGGAAAAGGCGCGCAAAGAC
AAGGAGGAGCGAGAGAAGAAGGAGCGCGAGCTCGCCGAGGAGCGGAGGAAGAAGCTGGCCGAAGATCTGAAGCAG
AAACGAGCGGCCGAGCGGCTGGAGAAGGAGAAGCGGGAGAAGGAGGCCCAGGCGCGCGAGGAGCAAAAGGCCAAG
GCCGAGGCCGCGACGGAGACGGCCGCGTCGTCATCGGCCACTGCGGCAGAGCCGACGCCTGGCCCCCGTGTCGGC
AGCTCGTACGCCTACTCGGCCGTCGGCGAGAAGACCAACATGTGGCCCAACGGCCGGCCCTCGGTGCCGTCTCAG
GCCGGCAGCTCGCCGTCCAAGGCCGGGTCGAGCGCGGGAAGGCGACCGCCGGCGCCGACGGCCAGGACGTACGTC
AGCACGGACGAGGACGGCTTCTCGTACAGACCGTACGACAAGGCCGGCAGGAGGTCGGGGCGCAGACCGTCCATG
TCGTCGGTGGGCGGATCCGAGTCGTCGTGGGCCCCCTCGCACACGACGGCGCGGACGTCGCCGCCGCCGTCGGTG
CGCGGCCCCTACTCGACCAAGGACCCGGACAAGATCGTCATCCAGGCCGTCTACCTCTTCATGAACCAGTTCGCC
AAGACGCCGGCCAGCCAGCTCGTGTCCGGGGTCGGATCGGTGACGGACGGCCTGATCCTGCGCATCACGACCGAG
GGCCTCTTCATCGACGACGACGTGCGCGGCGTGCCGCAGCGGGAATGGGACGTCAAGGCCTGGACGCTCAAGAAC
GTCGAGGCGTGGTGCCCGCCGCACTGTCTCAAGTCGGCGGCGTCGGTGGCGTCGAGCGCGGCGGCCGGGGCCAAG
AGCCCCCCCCACCTGCTGTACAAGATGGCGACGGCCCGGCGCAACGCGGACAAGGACAAGTTCCTGACGGGCGAC
GAGGCCGACGCGCACCTGACGGAGATGCTGCGGGCGTGCAAGGAGTGCTGCCGGCTGGGCCTGTGCGAGCGGCGC
TTCAAGAACACCACCATCCAGTCGCCGACGGGCCAGACGGGCGAGTGGAGAGACAAGGGCCTGCACGTCCTCCGG
GCCACGATCCGCGACCAGGAGGGGAAGCGCTACCTCTTCGTCCTCGACGAGACGGAGGGCTGGAAGGTGGCGGTC
GGGCTGCAGCGCCTGCGCCGCGGCACACAGGTGCGGCAGCTGGGCGTCGCCGGCATGGTGCCCTCGGAGGCCCGC
GGCACCCTGGAGACGCTGGGCTGGAGCGGCTGA
Gene >Hirsu2|10623
ATGAGTGGCCCTCCGCCTCCGCCTCCGCCCCATGGCGAGGTGCCTAGGTCCTCGGGCTTGCCGCCCGGCAAGTAC
GACATCTTCGTCATTCCCGAGCACTCGGCCGGCGCCGGCTTCCTCTACCTGCCCTCGATGCGGCCGAGTCCGAAC
AGCTTCGCCGCCGGCTTCGCCTCGGCCCTCATCCTCGTCGCCCTCTTCCAGAGCATGGCGCCCGCCTTCAAGGCC
TGGTGGGAGAGCTTCCAGGGCCTCGGCAACATGGGCATGACCCTGCTCATCATCGGCGTCGGCTTCGGCGCTTGG
GCTCTCGGTCGCACCCAAAAAGACGGCCCGGCTTCGGGCTACAGGCCTCATCATCCTCAGCCTGACCGTGGCCCT
GGCAGCGCCGGGGCCGGTTTCAGGCCCGCCACCTCGGCGCCGCCGCCACCCAACCCCGGGAGCCCTCCACCTCCG
CCACACGGCGGCAACACTGCTCCACCCCCTCCTCCCCCGCCGCCGCCGCCGCCTCCGCCGCAGACCGACGATGAC
GGCCCTCCACCTCCGCCTCCGCCACCTCCCCGGCGGGAGCAACGCGAGGAGACGCCCAAGACTTCTTGGCAGCGC
CCGCCTCCGCAAGCCGGGACGCCCAAGCCCGAGACGCCCAAGCCGGACACGCCCAAGGGGACCTGGGAAAAGGCG
CGCGAGGAGACGAGGAAAAAGGAAGAGGAGCGCAAGGCCAAGGAGGCGGAGAAGAAGCGTCGCGAGGACGCCGCC
CGAAGGCTGGCCGAACTGCGCGCCAGGGAGGCAAGAGAGAGGGAGGAGCGGGAAAAGGAAAAGGCGCGCAAAGAC
AAGGAGGAGCGAGAGAAGAAGGAGCGCGAGCTCGCCGAGGAGCGGAGGAAGAAGCTGGCCGAAGATCTGAAGCAG
AAACGAGCGGCCGAGCGGCTGGAGAAGGAGAAGCGGGAGAAGGAGGCCCAGGCGCGCGAGGAGCAAAAGGCCAAG
GCCGAGGCCGCGACGGAGACGGCCGCGTCGTCATCGGCCACTGCGGCAGAGCCGACGCCTGGCCCCCGTGTCGGC
AGCTCGTACGCCTACTCGGCCGTCGGCGAGAAGACCAACATGTGGCCCAACGGCCGGCCCTCGGTGCCGTCTCAG
GCCGGCAGCTCGCCGTCCAAGGCCGGGTCGAGCGCGGGAAGGCGACCGCCGGCGCCGACGGCCAGGACGTACGTC
AGCACGGACGAGGACGGCTTCTCGTACAGACCGTACGACAAGGCCGGCAGGAGGTCGGGGCGCAGACCGTCCATG
TCGTCGGTGGGCGGATCCGAGTCGTCGTGGGCCCCCTCGCACACGACGGCGCGGACGTCGCCGCCGCCGTCGGTG
CGCGGCCCCTACTCGACCAAGGACCCGGACAAGATCGTCATCCAGGCCGTCTACCTCTTCATGAACCAGTTCGCC
AAGACGCCGGCCAGCCAGCTCGTGTCCGGGGTCGGATCGGTGACGGACGGCCTGATCCTGCGCATCACGACCGAG
GGCCTCTTCATCGACGACGACGTGCGCGGCGTGCCGCAGCGGGAATGGGACGTCAAGGCCTGGACGCTCAAGAAC
GTCGAGGCGTGGTGCCCGCCGCACTGTCTCAAGTCGGCGGCGTCGGTGGCGTCGAGCGCGGCGGCCGGGGCCAAG
AGCCCCCCCCACCTGCTGTACAAGATGGCGACGGCCCGGCGCAACGCGGACAAGGACAAGTTCCTGACGGGCGAC
GAGGCCGACGCGCACCTGACGGAGATGCTGCGGGCGTGCAAGGAGTGCTGCCGGCTGGGCCTGTGCGAGCGGCGC
TTCAAGAACACCACCATCCAGTCGCCGACGGGCCAGACGGGCGAGTGGAGAGACAAGGGCCTGCACGTCCTCCGG
GCCACGATCCGCGACCAGGAGGGGAAGCGCTACCTCTTCGTCCTCGACGAGACGGAGGGCTGGAAGGTGGCGGTC
GGGCTGCAGCGCCTGCGCCGCGGCACACAGGTGCGGCAGCTGGGCGTCGCCGGCATGGTGCCCTCGGAGGCCCGC
GGCACCCTGGAGACGCTGGGCTGGAGCGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail