Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10618
Gene name
LocationContig_877:6403..7124
Strand-
Gene length (bp)721
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00472 RF-1 RF-1 domain 8.4E-14 66 189

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12322|YO114_YEAST Putative uncharacterized protein YOL114C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL114C PE=4 SV=1 45 189 4.0E-16
sp|Q9HDZ3|MUG82_SCHPO Meiotically up-regulated gene 82 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug82 PE=1 SV=1 66 140 1.0E-06

GO

GO Term Description Terminal node
GO:0006415 translational termination Yes
GO:0003747 translation release factor activity Yes
GO:0008135 translation factor activity, RNA binding No
GO:0005488 binding No
GO:0045182 translation regulator activity No
GO:0016043 cellular component organization No
GO:0032984 protein-containing complex disassembly No
GO:0008079 translation termination factor activity No
GO:0003674 molecular_function No
GO:0043933 protein-containing complex subunit organization No
GO:0003676 nucleic acid binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0003723 RNA binding No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0022411 cellular component disassembly No
GO:0009987 cellular process No
GO:0043624 cellular protein complex disassembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10618
MLPRPLRRIVLAAPVSSETLGPRPLISVRFKRYEAYDAQFDQEALADARSWYRNFDASQLPHGSTTYARSSGPGG
QHVNKTETKAITTIPVKELLAMLPQALHSGVRASKYYTAGSDCLTFHAQTQRSRTANAEENRSKLMEEVTRLFQD
KIPAETSNEKKKKHEEIAKKFHTTRIKTKKLMSSKKQHRRGQSD*
Coding >Hirsu2|10618
ATGCTTCCTCGCCCCCTACGCAGAATCGTGCTGGCGGCACCCGTGTCGAGCGAGACGCTTGGTCCACGTCCCCTG
ATATCAGTCCGGTTCAAGAGATACGAGGCCTACGATGCCCAGTTCGACCAGGAGGCTTTGGCCGACGCAAGATCT
TGGTACCGGAATTTTGATGCGTCTCAGCTCCCGCACGGCAGCACAACGTATGCGAGGTCCAGCGGCCCCGGCGGC
CAGCATGTCAACAAGACCGAGACCAAGGCCATCACGACCATTCCGGTCAAGGAGCTCCTCGCAATGCTGCCCCAG
GCTCTCCATTCTGGCGTCCGCGCCTCAAAGTACTACACTGCCGGAAGCGATTGCCTCACCTTTCACGCCCAGACG
CAGAGGTCCCGAACGGCCAATGCCGAGGAAAACCGGAGCAAGCTCATGGAGGAGGTGACACGCCTGTTCCAAGAC
AAGATCCCCGCCGAGACGAGCAATGAAAAGAAAAAGAAGCACGAGGAGATAGCCAAGAAATTCCACACGACACGG
ATCAAGACAAAGAAATTGATGAGCTCCAAGAAACAACACCGCCGAGGTCAATCGGATTGA
Transcript >Hirsu2|10618
ATGCTTCCTCGCCCCCTACGCAGAATCGTGCTGGCGGCACCCGTGTCGAGCGAGACGCTTGGTCCACGTCCCCTG
ATATCAGTCCGGTTCAAGAGATACGAGGCCTACGATGCCCAGTTCGACCAGGAGGCTTTGGCCGACGCAAGATCT
TGGTACCGGAATTTTGATGCGTCTCAGCTCCCGCACGGCAGCACAACGTATGCGAGGTCCAGCGGCCCCGGCGGC
CAGCATGTCAACAAGACCGAGACCAAGGCCATCACGACCATTCCGGTCAAGGAGCTCCTCGCAATGCTGCCCCAG
GCTCTCCATTCTGGCGTCCGCGCCTCAAAGTACTACACTGCCGGAAGCGATTGCCTCACCTTTCACGCCCAGACG
CAGAGGTCCCGAACGGCCAATGCCGAGGAAAACCGGAGCAAGCTCATGGAGGAGGTGACACGCCTGTTCCAAGAC
AAGATCCCCGCCGAGACGAGCAATGAAAAGAAAAAGAAGCACGAGGAGATAGCCAAGAAATTCCACACGACACGG
ATCAAGACAAAGAAATTGATGAGCTCCAAGAAACAACACCGCCGAGGTCAATCGGATTGA
Gene >Hirsu2|10618
ATGCTTCCTCGCCCCCTACGCAGAATCGTGCTGGCGGCACCCGTGTCGAGCGAGACGCTTGGTCCACGTCCCCTG
ATATCAGTCCGGTTCAAGAGATACGAGGCCTACGATGCCCAGTTCGACCAGGAGGCTTTGGCCGACGCAAGATCT
TGGTACCGGAATTTTGATGCGTCTCAGCTCCCGCACGGCAGCACAACGTATGCGAGGTCCAGCGGCCCCGGCGGC
CAGCATGTCAACAAGTACGAGGCCCGCAATGCCTAGTAGACTACAAGACCCATCGGCGCGTGAGAACAAGACGAG
ACTGACGAGCGAGCCAAGGACCGAGACCAAGGCCATCACGACCATTCCGGTCAAGGAGCTCCTCGCAATGCTGCC
CCAGGCTCTCCATTCTGGCGTCCGCGCCTCAAAGTACTACACTGCCGGAAGCGATTGCCTCACCTTTCACGCCCA
GACGCAGAGGTCCCGAACGGCCAATGCCGAGGAAAACCGGAGCAAGCTCATGGAGGAGGTGACACGCCTGTTCCA
AGACAAGATCCCCGCCGAGACGAGCAATGAAAAGAAAAAGAAGCACGAGGAGATGTGAGCGCAACGGTTCGTAAC
GTAGGCATACCCGCGACTGACCAACGACGTCTGCAGAGCCAAGAAATTCCACACGACACGGATCAAGACAAAGAA
ATTGATGAGCTCCAAGAAACAACACCGCCGAGGTCAATCGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail