Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10601
Gene name
LocationContig_874:4288..5690
Strand-
Gene length (bp)1402
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 3.9E-43 57 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B5W2|HUT1_EMENI UDP-galactose transporter homolog 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hut1 PE=3 SV=1 1 395 2.0E-135
sp|Q4WJM7|HUT1_ASPFU UDP-galactose transporter homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hut1 PE=3 SV=1 12 407 3.0E-130
sp|Q6C4X5|HUT1_YARLI UDP-galactose transporter homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HUT1 PE=3 SV=1 15 396 1.0E-90
sp|Q5ADN8|HUT1_CANAL UDP-galactose transporter homolog 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HUT1 PE=3 SV=1 58 406 2.0E-79
sp|Q4P9R2|HUT1_USTMA UDP-galactose transporter homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HUT1 PE=3 SV=2 55 406 2.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B5W2|HUT1_EMENI UDP-galactose transporter homolog 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hut1 PE=3 SV=1 1 395 2.0E-135
sp|Q4WJM7|HUT1_ASPFU UDP-galactose transporter homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hut1 PE=3 SV=1 12 407 3.0E-130
sp|Q6C4X5|HUT1_YARLI UDP-galactose transporter homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HUT1 PE=3 SV=1 15 396 1.0E-90
sp|Q5ADN8|HUT1_CANAL UDP-galactose transporter homolog 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HUT1 PE=3 SV=1 58 406 2.0E-79
sp|Q4P9R2|HUT1_USTMA UDP-galactose transporter homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HUT1 PE=3 SV=2 55 406 2.0E-70
sp|Q6BMV3|HUT1_DEBHA UDP-galactose transporter homolog 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HUT1 PE=3 SV=2 64 406 2.0E-68
sp|Q8WZJ9|HUT1_SCHPO UDP-galactose transporter homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hut1 PE=3 SV=1 57 406 1.0E-64
sp|P0CP32|HUT1_CRYNJ UDP-galactose transporter homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HUT1-A PE=3 SV=1 54 399 6.0E-63
sp|P0CP33|HUT1_CRYNB UDP-galactose transporter homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HUT1-A PE=3 SV=1 54 399 6.0E-63
sp|Q12520|HUT1_YEAST UDP-galactose transporter homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUT1 PE=1 SV=1 58 403 3.0E-61
sp|Q755H7|HUT1_ASHGO UDP-galactose transporter homolog 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HUT1 PE=3 SV=2 57 385 5.0E-60
sp|Q6CR04|HUT1_KLULA UDP-galactose transporter homolog 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HUT1 PE=3 SV=1 59 396 8.0E-57
sp|Q6FSF8|HUT1_CANGA UDP-galactose transporter homolog 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HUT1 PE=3 SV=1 64 405 2.0E-54
sp|Q54I86|S35B1_DICDI Solute carrier family 35 member B1 OS=Dictyostelium discoideum GN=slc35b1 PE=3 SV=2 58 396 2.0E-40
sp|O64503|UTR1_ARATH UDP-galactose/UDP-glucose transporter 1 OS=Arabidopsis thaliana GN=UTR1 PE=1 SV=1 58 406 4.0E-39
sp|Q9M9S6|UTR3_ARATH UDP-galactose/UDP-glucose transporter 3 OS=Arabidopsis thaliana GN=UTR3 PE=1 SV=1 58 403 2.0E-38
sp|P97858|S35B1_MOUSE Solute carrier family 35 member B1 OS=Mus musculus GN=Slc35b1 PE=1 SV=1 50 396 3.0E-35
sp|Q6GQ70|S35B1_XENLA Solute carrier family 35 member B1 OS=Xenopus laevis GN=slc35b1 PE=2 SV=1 47 396 1.0E-34
sp|Q8AWB6|S35B1_CHICK Solute carrier family 35 member B1 OS=Gallus gallus GN=SLC35B1 PE=2 SV=1 50 396 1.0E-32
sp|Q9VEI3|S35B2_DROME Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Drosophila melanogaster GN=sll PE=1 SV=1 26 406 2.0E-32
sp|Q8AXS6|S35B1_XENTR Solute carrier family 35 member B1 OS=Xenopus tropicalis GN=slc35b1 PE=2 SV=2 57 396 2.0E-32
sp|Q6V7K3|S35B1_RAT Solute carrier family 35 member B1 OS=Rattus norvegicus GN=Slc35b1 PE=2 SV=1 50 396 2.0E-32
sp|Q66HX0|S35B1_DANRE Solute carrier family 35 member B1 OS=Danio rerio GN=slc35b1 PE=2 SV=1 57 396 2.0E-31
sp|Q55DM5|S35B2_DICDI Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Dictyostelium discoideum GN=slc35b2 PE=3 SV=1 45 396 4.0E-31
sp|P78383|S35B1_HUMAN Solute carrier family 35 member B1 OS=Homo sapiens GN=SLC35B1 PE=1 SV=1 50 396 5.0E-31
sp|Q8MII5|S35B1_BOVIN Solute carrier family 35 member B1 OS=Bos taurus GN=SLC35B1 PE=2 SV=2 50 396 8.0E-31
sp|Q6NMB6|UTR5B_ARATH UDP-galactose/UDP-glucose transporter 5B OS=Arabidopsis thaliana GN=At5g59740 PE=2 SV=1 59 400 1.0E-29
sp|Q9VDD7|S35B1_DROME Solute carrier family 35 member B1 homolog OS=Drosophila melanogaster GN=meigo PE=2 SV=1 57 398 6.0E-29
sp|Q6NM25|UTR5_ARATH UDP-galactose/UDP-glucose transporter 5 OS=Arabidopsis thaliana GN=UTR5 PE=2 SV=1 59 396 6.0E-28
sp|Q8TB61|S35B2_HUMAN Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Homo sapiens GN=SLC35B2 PE=1 SV=1 57 368 9.0E-25
sp|Q5R9A1|S35B2_PONAB Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Pongo abelii GN=SLC35B2 PE=2 SV=2 57 368 2.0E-24
sp|Q91ZN5|S35B2_MOUSE Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Mus musculus GN=Slc35b2 PE=1 SV=1 57 368 3.0E-24
sp|Q8MXJ9|S35B2_CAEEL Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Caenorhabditis elegans GN=pst-1 PE=3 SV=4 58 388 1.0E-13
sp|Q9LDX3|UTR4_ARATH UDP-galactose/UDP-glucose transporter 4 OS=Arabidopsis thaliana GN=UTR4 PE=2 SV=1 153 385 1.0E-11
sp|Q7Q5D4|S35B3_ANOGA Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Anopheles gambiae GN=Papst2 PE=3 SV=4 57 383 2.0E-10
sp|Q922Q5|S35B3_MOUSE Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Mus musculus GN=Slc35b3 PE=2 SV=1 53 406 7.0E-10
sp|Q29Q28|UTR2_ARATH UDP-galactose/UDP-glucose transporter 2 OS=Arabidopsis thaliana GN=UTR2 PE=2 SV=1 109 385 2.0E-09
sp|Q5R831|S35B3_PONAB Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Pongo abelii GN=SLC35B3 PE=2 SV=1 55 397 3.0E-09
sp|Q17CE7|S35B3_AEDAE Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Aedes aegypti GN=Papst2 PE=3 SV=1 57 383 5.0E-08
sp|Q9H1N7|S35B3_HUMAN Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Homo sapiens GN=SLC35B3 PE=1 SV=1 55 383 5.0E-08
sp|Q9VVD9|S35B3_DROME Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Drosophila melanogaster GN=Papst2 PE=1 SV=2 57 381 2.0E-07
sp|Q9W429|S35B4_DROME UDP-xylose and UDP-N-acetylglucosamine transporter OS=Drosophila melanogaster GN=Efr PE=2 SV=1 163 406 4.0E-07
sp|Q61LC0|S35B3_CAEBR Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Caenorhabditis briggsae GN=pst-2 PE=3 SV=1 57 366 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 90 112 22
3 132 154 22
4 159 181 22
5 188 205 17
6 220 242 22
7 263 285 22
8 328 350 22
9 370 392 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10601
MARTKQAAVRREASSEYFNRQTAAWEAGADANGHAAAAAAAKMPTPATGPEPAGLPQLVIAVGGIYGTFLTWAYL
QEKLTTTRYGPEQERWHYPVFLNTVQSALAALVGFVYLHGTTPRGAAAAPVIPSRRILAPLAVVAVTSSLASPFG
YASLAHIDYITFLLAKSCKLLPVMFLHVVLFRRRYPLYKYLVVAAVTAGVALFTLHSGRGRHGKGSDARAGGDAS
LGWGLLLLSVNLLFDGLTNSTQDYVFHAFRPYGGPQMMCANNVMSTLVTAAYLVASPALVATGLGDWLGMDAAGS
AGELAAALGFMARHPSVWKDVLGFAACGAVGQVFIFYTLATFSSVLLVTVTVTRKMVTMMLSVVAFGHRLSGMQW
LGVGLVFGGIGVEAAIARREKMARQAAAAKKGL*
Coding >Hirsu2|10601
ATGGCTCGCACCAAGCAGGCGGCCGTCCGGCGCGAGGCGTCGTCCGAGTACTTCAACCGCCAGACGGCGGCGTGG
GAGGCCGGTGCCGACGCCAACGGGCATGCCGCCGCCGCCGCCGCCGCCAAGATGCCGACGCCGGCGACGGGCCCC
GAGCCGGCCGGGCTGCCGCAGCTCGTCATTGCCGTCGGGGGCATCTATGGGACCTTCCTGACGTGGGCGTACCTG
CAGGAGAAGCTGACGACGACTCGGTACGGCCCGGAGCAGGAGCGGTGGCACTACCCCGTCTTCCTCAACACGGTG
CAGTCGGCGCTGGCGGCGCTCGTCGGCTTCGTCTACCTGCACGGGACGACGCCGCGGGGCGCAGCCGCGGCGCCC
GTGATCCCGTCGCGCCGCATCCTCGCCCCGCTGGCCGTCGTGGCCGTCACCAGCAGCCTGGCCAGCCCGTTCGGC
TACGCCAGCCTGGCCCACATCGACTACATCACCTTCCTGCTGGCCAAGAGCTGCAAGCTGCTGCCCGTCATGTTC
CTGCACGTCGTCCTCTTCCGCCGCCGCTACCCGCTCTACAAGTACCTGGTCGTCGCCGCCGTCACCGCCGGCGTC
GCCCTCTTCACCCTCCACTCCGGCCGCGGCCGCCACGGCAAGGGCTCCGACGCCCGCGCCGGCGGCGACGCCAGC
CTCGGCTGGGGCCTGCTGCTGCTCTCCGTCAACCTCCTCTTCGACGGCCTGACCAACAGCACCCAGGACTACGTC
TTCCACGCCTTCCGCCCCTACGGCGGCCCGCAGATGATGTGCGCCAACAACGTCATGAGCACCCTCGTCACCGCC
GCCTACCTCGTCGCCAGCCCCGCCCTCGTCGCCACCGGCCTCGGCGACTGGCTCGGCATGGACGCCGCCGGCAGC
GCCGGCGAGCTCGCCGCCGCCCTCGGCTTCATGGCCCGCCACCCGTCCGTGTGGAAGGACGTGCTGGGCTTTGCC
GCCTGCGGCGCCGTCGGCCAGGTCTTCATCTTCTACACCCTCGCTACCTTCTCCTCCGTCCTCCTCGTCACGGTG
ACGGTGACGCGCAAGATGGTCACCATGATGCTGTCCGTCGTCGCCTTCGGCCACCGCCTCTCCGGCATGCAGTGG
CTCGGCGTCGGCCTCGTCTTCGGCGGCATCGGCGTCGAGGCCGCCATCGCCCGCCGCGAGAAGATGGCCCGCCAG
GCCGCCGCCGCCAAGAAGGGCTTGTGA
Transcript >Hirsu2|10601
ATGGCTCGCACCAAGCAGGCGGCCGTCCGGCGCGAGGCGTCGTCCGAGTACTTCAACCGCCAGACGGCGGCGTGG
GAGGCCGGTGCCGACGCCAACGGGCATGCCGCCGCCGCCGCCGCCGCCAAGATGCCGACGCCGGCGACGGGCCCC
GAGCCGGCCGGGCTGCCGCAGCTCGTCATTGCCGTCGGGGGCATCTATGGGACCTTCCTGACGTGGGCGTACCTG
CAGGAGAAGCTGACGACGACTCGGTACGGCCCGGAGCAGGAGCGGTGGCACTACCCCGTCTTCCTCAACACGGTG
CAGTCGGCGCTGGCGGCGCTCGTCGGCTTCGTCTACCTGCACGGGACGACGCCGCGGGGCGCAGCCGCGGCGCCC
GTGATCCCGTCGCGCCGCATCCTCGCCCCGCTGGCCGTCGTGGCCGTCACCAGCAGCCTGGCCAGCCCGTTCGGC
TACGCCAGCCTGGCCCACATCGACTACATCACCTTCCTGCTGGCCAAGAGCTGCAAGCTGCTGCCCGTCATGTTC
CTGCACGTCGTCCTCTTCCGCCGCCGCTACCCGCTCTACAAGTACCTGGTCGTCGCCGCCGTCACCGCCGGCGTC
GCCCTCTTCACCCTCCACTCCGGCCGCGGCCGCCACGGCAAGGGCTCCGACGCCCGCGCCGGCGGCGACGCCAGC
CTCGGCTGGGGCCTGCTGCTGCTCTCCGTCAACCTCCTCTTCGACGGCCTGACCAACAGCACCCAGGACTACGTC
TTCCACGCCTTCCGCCCCTACGGCGGCCCGCAGATGATGTGCGCCAACAACGTCATGAGCACCCTCGTCACCGCC
GCCTACCTCGTCGCCAGCCCCGCCCTCGTCGCCACCGGCCTCGGCGACTGGCTCGGCATGGACGCCGCCGGCAGC
GCCGGCGAGCTCGCCGCCGCCCTCGGCTTCATGGCCCGCCACCCGTCCGTGTGGAAGGACGTGCTGGGCTTTGCC
GCCTGCGGCGCCGTCGGCCAGGTCTTCATCTTCTACACCCTCGCTACCTTCTCCTCCGTCCTCCTCGTCACGGTG
ACGGTGACGCGCAAGATGGTCACCATGATGCTGTCCGTCGTCGCCTTCGGCCACCGCCTCTCCGGCATGCAGTGG
CTCGGCGTCGGCCTCGTCTTCGGCGGCATCGGCGTCGAGGCCGCCATCGCCCGCCGCGAGAAGATGGCCCGCCAG
GCCGCCGCCGCCAAGAAGGGCTTGTGA
Gene >Hirsu2|10601
ATGGCTCGCACCAAGCAGGCGGCCGTCCGGCGCGAGGCGTCGTCCGAGTACTTCAACCGCCAGACGGCGGCGTGG
GAGGCCGGTGCCGACGCCAACGGGCATGCCGCCGCCGCCGCCGCCGCCAAGATGCCGACGCCGGCGACGGGCCCC
GAGCCGGCCGGGCTGCCGCAGCTCGTCATTGCCGTCGGGGGCATCTATGGGACCTTGTGGGTTTTCGTCTCTGCC
CCATCCGCTGCTTCTTCTCCCCTCTCCCCTTGTGTGTCTTTTTCGAAACTGACCCGCGCGACACCCAGCCTGACG
TGGGCGTACCTGCAGGAGAAGCTGACGACGACTCGGTACGGCCCGGAGCAGGAGCGGTGGCACTACCCCGTCTTC
CTCAACACGGTGCAGTCGGCGCTGGCGGCGCTCGTCGGCTTCGTCTACCTGCACGGGACGACGCCGCGGGGCGCA
GCCGCGGCGCCCGTGATCCCGTCGCGCCGCATCCTCGCCCCGCTGGCCGTCGTGGCCGTCACCAGCAGCCTGGCC
AGCCCGTTCGGCTACGCCAGCCTGGCCCACATCGACTACATCACCTTCCTGCTGGCCAAGAGCTGCAAGCTGCTG
CCCGTCATGTTCCTGCACGTCGTCCTCTTCCGCCGCCGCTACCCGCTCTACAAGTACCTGGTCGTCGCCGCCGTC
ACCGCCGGCGTCGCCCTCTTCACCCTCCACTCCGGCCGCGGCCGCCACGGCAAGGGCTCCGACGCCCGCGCCGGC
GGCGACGCCAGCCTCGGCTGGGGCCTGCTGCTGCTCTCCGTCAACCTCCTCTTCGACGGCCTGACCAACAGCACC
CAGGACTACGTCTTCCACGCCTTCCGCCCCTACGGCGGCCCGCAGATGATGTGCGCCAACAACGTCATGAGCACC
CTCGTCACCGCCGCCTACCTCGTCGCCAGCCCCGCCCTCGTCGCCACCGGCCTCGGCGACTGGCTCGGCATGGAC
GCCGCCGGCAGCGCCGGCGAGCTCGCCGCCGCCCTCGGCTTCATGGCCCGCCACCCGTCCGTGTGGAAGGACGTG
CTGGGCTTTGCCGCCTGCGGCGCCGTCGGCCAGGTCTTCATCTGTGAGATCCTCCTCCTCCTCCTCCTCCTCCTC
CTCCTCCTTCTCGCCCCCACCGACACCGTCATCACTGACCGGAGCGCGCCGCACAGTCTACACCCTCGCTACCTT
CTCCTCCGTCCTCCTCGTCACGGTGACGGTGACGCGCAAGATGGTCACCATGATGCTGTCCGTCGTCGCCTTCGG
CCACCGCCTCTCCGGCATGCAGTGGCTCGGCGTCGGCCTCGTCTTCGGCGGCATCGGCGTCGAGGCCGCCATCGC
CCGCCGCGAGAAGATGGCCCGCCAGGCCGCCGCCGCCAAGAAGGGCTTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail