Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10599
Gene name
LocationContig_873:7526..7811
Strand-
Gene length (bp)285
Transcript length (bp)285
Coding sequence length (bp)285
Protein length (aa) 95

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 7.2E-08 5 45
PF01266 DAO FAD dependent oxidoreductase 7.5E-07 2 37
PF01494 FAD_binding_3 FAD binding domain 5.4E-06 2 58
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 1.5E-04 2 41
PF00890 FAD_binding_2 FAD binding domain 1.1E-04 3 35

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0050660 flavin adenine dinucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.5154 0.3942 0.7742 0.0902 0.0802 0.0252 0.0627 0.0255 0.0387 0.0159

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup479
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1118
Ophiocordyceps australis 1348a (Ghana) OphauG2|3185
Ophiocordyceps australis map64 (Brazil) OphauB2|1595
Ophiocordyceps australis map64 (Brazil) OphauB2|1649
Ophiocordyceps australis map64 (Brazil) OphauB2|8025
Ophiocordyceps subramaniannii Hirsu2|10599 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5957
Ophiocordyceps subramaniannii Hirsu2|9131

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10599
MKVLIAGAGLSGLGAAFCLARRGHEVHLFERHAQVASRGGDINTRPSASRIMHSWGLGPELGKIAMQSPSVVIRD
LQSGAIAMRTFSHASAYRD*
Coding >Hirsu2|10599
ATGAAGGTGCTCATAGCCGGAGCCGGTCTCAGCGGCCTCGGCGCCGCCTTCTGCCTTGCCAGACGCGGACACGAG
GTCCACCTCTTTGAGCGCCACGCACAGGTTGCCTCTCGCGGAGGCGACATCAACACTCGGCCGAGCGCCAGCCGG
ATCATGCATTCCTGGGGGCTTGGACCGGAGCTGGGGAAGATCGCTATGCAGAGTCCGTCCGTCGTCATCCGGGAC
CTGCAGTCTGGAGCGATCGCCATGCGGACCTTCTCGCACGCCTCAGCGTATCGGGACTAG
Transcript >Hirsu2|10599
ATGAAGGTGCTCATAGCCGGAGCCGGTCTCAGCGGCCTCGGCGCCGCCTTCTGCCTTGCCAGACGCGGACACGAG
GTCCACCTCTTTGAGCGCCACGCACAGGTTGCCTCTCGCGGAGGCGACATCAACACTCGGCCGAGCGCCAGCCGG
ATCATGCATTCCTGGGGGCTTGGACCGGAGCTGGGGAAGATCGCTATGCAGAGTCCGTCCGTCGTCATCCGGGAC
CTGCAGTCTGGAGCGATCGCCATGCGGACCTTCTCGCACGCCTCAGCGTATCGGGACTAG
Gene >Hirsu2|10599
ATGAAGGTGCTCATAGCCGGAGCCGGTCTCAGCGGCCTCGGCGCCGCCTTCTGCCTTGCCAGACGCGGACACGAG
GTCCACCTCTTTGAGCGCCACGCACAGGTTGCCTCTCGCGGAGGCGACATCAACACTCGGCCGAGCGCCAGCCGG
ATCATGCATTCCTGGGGGCTTGGACCGGAGCTGGGGAAGATCGCTATGCAGAGTCCGTCCGTCGTCATCCGGGAC
CTGCAGTCTGGAGCGATCGCCATGCGGACCTTCTCGCACGCCTCAGCGTATCGGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail