Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10599
Gene name
LocationContig_873:7526..7811
Strand-
Gene length (bp)285
Transcript length (bp)285
Coding sequence length (bp)285
Protein length (aa) 95

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 7.5E-08 5 45
PF01494 FAD_binding_3 FAD binding domain 5.0E-06 2 58
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 1.2E-04 2 40
PF00890 FAD_binding_2 FAD binding domain 1.0E-04 3 35

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10599
MKVLIAGAGLSGLGAAFCLARRGHEVHLFERHAQVASRGGDINTRPSASRIMHSWGLGPELGKIAMQSPSVVIRD
LQSGAIAMRTFSHASAYRD*
Coding >Hirsu2|10599
ATGAAGGTGCTCATAGCCGGAGCCGGTCTCAGCGGCCTCGGCGCCGCCTTCTGCCTTGCCAGACGCGGACACGAG
GTCCACCTCTTTGAGCGCCACGCACAGGTTGCCTCTCGCGGAGGCGACATCAACACTCGGCCGAGCGCCAGCCGG
ATCATGCATTCCTGGGGGCTTGGACCGGAGCTGGGGAAGATCGCTATGCAGAGTCCGTCCGTCGTCATCCGGGAC
CTGCAGTCTGGAGCGATCGCCATGCGGACCTTCTCGCACGCCTCAGCGTATCGGGACTAG
Transcript >Hirsu2|10599
ATGAAGGTGCTCATAGCCGGAGCCGGTCTCAGCGGCCTCGGCGCCGCCTTCTGCCTTGCCAGACGCGGACACGAG
GTCCACCTCTTTGAGCGCCACGCACAGGTTGCCTCTCGCGGAGGCGACATCAACACTCGGCCGAGCGCCAGCCGG
ATCATGCATTCCTGGGGGCTTGGACCGGAGCTGGGGAAGATCGCTATGCAGAGTCCGTCCGTCGTCATCCGGGAC
CTGCAGTCTGGAGCGATCGCCATGCGGACCTTCTCGCACGCCTCAGCGTATCGGGACTAG
Gene >Hirsu2|10599
ATGAAGGTGCTCATAGCCGGAGCCGGTCTCAGCGGCCTCGGCGCCGCCTTCTGCCTTGCCAGACGCGGACACGAG
GTCCACCTCTTTGAGCGCCACGCACAGGTTGCCTCTCGCGGAGGCGACATCAACACTCGGCCGAGCGCCAGCCGG
ATCATGCATTCCTGGGGGCTTGGACCGGAGCTGGGGAAGATCGCTATGCAGAGTCCGTCCGTCGTCATCCGGGAC
CTGCAGTCTGGAGCGATCGCCATGCGGACCTTCTCGCACGCCTCAGCGTATCGGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail