Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10594
Gene name
LocationContig_872:7321..10852
Strand-
Gene length (bp)3531
Transcript length (bp)3531
Coding sequence length (bp)3531
Protein length (aa) 1177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.4E-03 921 941

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10594
MASTFALAPGPFKGQEPDGRHLNPPAFVPQRLPPTVAGDQVFHCVSLSPAAPQFETPLTACSNLSTNLSQYQPSD
FSDFDEDPFFGASLDLLDDAADLHDPLALRAKGVAATVTTTAKTMAKQPHDNRDGASYPLTPTHTASVHTTTPTS
EPRGSIAPLSADDIPDSISPEELQMPFHPPHAVVQPSDLTSSHAGSHRNSEDSLAPRPVAVNPQSPRVTVSVWDK
SDGPRVDAVARTFDEDGQCAARSDLRSAGDLISSAHRPHFSAAAPDAPGSWHQTSPPHRIGLDPRHRPIDEVPSI
NEVATRRNAQRRNRDVSNWLANQLDESSAPQDTSSHDMCAMEKLRQDTQDGIPLGDQTENRFVPGQTYYNEAGGG
PLTQEDREIIAEDHKWADAPMLQHIALSPGRATQPQSSQAAIERFERLCRDNDSILSRSATWGTRRRSHPSVLDA
DIENVTGGNFLKKLTIGRGSGDKGSSRSGGLLKDLRGLVRRPSASSLRKRARSRSHGTADEEPAEQPSGGEQPQR
GKRDSTPHLSPTPRSPSWGRKPTPSLNTALVSMAQSIVNIGTAVPRSGGSSPMPSPRIGLSMRNTLRRPRSKSEV
PKASATSAGVPAESHPNLIEMWKKTGGPPVTPLGKTMNLGGGGGWAAGGGPDDDDDDDDDDFDEDNDMRTNPNII
DSLSPDFAGFQQHLLTLNPGLDLSHGYLVERISQQQVIRYKQLLNTKIKHLGLGGGCPCGPLCVALGGSANVLDH
QKSDGQEANEAADDGVPAEGVIGKESFPRDIPMPPTSRLPAEFECQLCFQRKRFQKPSDWTKHVHEDVQPFTCTW
DKCRDAKMFKRKADWVRHENEGHRHLEWWTCDVEDCRHTCYRRDNFLQHLVREHKFVEPKIKTKAAMKRSGGLDP
TWVRVEQCHIETSTRPQDEPCRFCGKAFPTWKKLTVHLAKHMEQIALPVLRLVAARELTAETVVSPVQDLAPRPM
IPLPEQPPPGARFPVAAQWQHQQQASLHGYRQPPPYAGQGPFMYSLPTPEQTQHPSSFYGPQFHNNSQVLKQPAM
GLEGMNQGYETNPQRVRAMSGSSHAFAQAPSAYMVPNSSSKEAPAPAEPFRQVNGLGLQNVGDGSLGGGMVSYET
MMDPCGIYGSPFSGRGSLSTPASTFSPSFQNGRGMGRHDQAWDDGRQAKFM*
Coding >Hirsu2|10594
ATGGCTTCTACCTTCGCTCTGGCCCCCGGGCCCTTCAAAGGCCAGGAGCCCGACGGTCGCCACCTCAACCCGCCC
GCCTTCGTCCCTCAGCGCCTCCCGCCTACAGTGGCTGGCGACCAGGTTTTTCATTGCGTCTCCTTGTCGCCCGCT
GCACCCCAATTCGAGACGCCCCTCACCGCCTGCTCCAACCTCAGCACCAACCTCAGCCAATACCAACCCAGCGAC
TTCAGTGACTTCGACGAGGATCCCTTCTTCGGAGCCAGCTTAGACCTCCTCGACGACGCCGCTGACTTACATGAC
CCCCTCGCTCTGCGCGCCAAGGGAGTCGCCGCTACGGTCACAACCACGGCCAAAACCATGGCGAAGCAACCTCAC
GATAACCGCGACGGCGCATCCTACCCTCTGACCCCAACCCACACTGCTTCCGTCCACACCACAACGCCCACGAGC
GAGCCCAGGGGCTCCATAGCACCTTTGTCGGCCGACGACATCCCGGACTCCATCTCTCCCGAGGAGCTCCAGATG
CCCTTCCACCCCCCCCACGCCGTCGTCCAGCCGTCCGACCTCACTTCCAGCCACGCCGGCAGTCATCGCAACAGC
GAGGACAGCCTGGCCCCGCGCCCCGTCGCCGTCAATCCTCAGAGCCCGAGGGTCACCGTCTCCGTGTGGGACAAG
AGTGACGGCCCGCGGGTCGATGCCGTCGCACGGACCTTTGACGAGGATGGCCAATGCGCCGCACGGAGCGACCTC
CGTTCTGCCGGCGATCTCATCTCCTCGGCCCATCGCCCGCACTTCTCCGCCGCCGCCCCGGATGCGCCCGGAAGC
TGGCACCAGACCTCGCCCCCACACCGCATCGGCCTCGATCCCCGCCACCGTCCTATCGACGAGGTCCCCAGTATC
AACGAGGTGGCGACGCGGCGAAACGCCCAACGGCGCAACCGGGATGTCAGCAATTGGCTCGCCAACCAGCTCGAC
GAGTCCTCAGCGCCCCAGGACACGAGCTCCCACGACATGTGCGCCATGGAGAAGCTCCGCCAGGACACACAAGAC
GGCATTCCTCTCGGCGACCAGACGGAAAACCGATTCGTTCCCGGCCAGACCTACTACAACGAGGCGGGCGGCGGC
CCCCTGACGCAGGAGGACCGGGAAATCATCGCCGAGGACCACAAATGGGCTGATGCCCCCATGCTGCAGCACATT
GCCTTGAGCCCAGGTCGTGCTACCCAGCCGCAATCCTCTCAAGCTGCCATCGAGCGGTTTGAGAGGCTGTGCCGT
GACAACGACTCCATCCTCTCGAGGTCCGCCACCTGGGGAACCCGTCGGCGGAGTCACCCCAGCGTCTTGGATGCC
GACATCGAAAACGTCACGGGCGGCAACTTCTTGAAGAAGCTGACGATTGGTCGCGGAAGCGGCGACAAGGGCAGC
AGCAGGTCCGGGGGGCTACTGAAAGATCTTCGGGGGCTCGTCAGGCGGCCCAGCGCCAGTTCCCTGCGCAAGCGC
GCCCGCAGCCGCTCCCACGGAACCGCCGATGAGGAGCCCGCAGAGCAGCCGTCCGGAGGGGAGCAGCCGCAGCGG
GGCAAGCGTGATTCCACACCCCATCTGTCTCCCACGCCGCGTTCGCCGAGCTGGGGGCGGAAGCCCACGCCCAGC
CTGAACACGGCGTTGGTTTCTATGGCCCAGAGCATCGTTAACATCGGGACCGCCGTCCCGCGCAGCGGCGGCTCC
TCGCCCATGCCCTCTCCCAGGATCGGCCTGAGCATGAGGAACACGCTCAGGCGGCCTCGCAGCAAGTCTGAGGTC
CCCAAAGCATCCGCCACGTCGGCCGGCGTGCCGGCCGAGAGCCACCCGAACCTTATTGAGATGTGGAAGAAGACG
GGCGGCCCGCCGGTGACGCCCCTGGGTAAGACGATGAACCTCGGCGGCGGCGGCGGCTGGGCAGCAGGAGGGGGG
CCCGACGACGATGACGACGATGACGACGACGACTTTGACGAAGACAACGACATGAGGACGAACCCCAACATCATC
GACAGCCTCTCGCCCGATTTTGCAGGCTTCCAGCAGCACCTGCTGACGCTGAATCCTGGCCTCGACCTGTCACAC
GGCTACCTGGTCGAGCGCATCTCGCAGCAGCAGGTGATACGATACAAGCAGCTGCTCAACACCAAGATCAAGCAC
CTCGGCCTCGGCGGCGGCTGCCCATGCGGCCCGCTGTGCGTGGCCCTGGGCGGCTCGGCCAACGTGCTCGACCAC
CAGAAGAGCGATGGGCAGGAGGCGAACGAGGCGGCCGACGACGGTGTCCCGGCCGAGGGCGTCATCGGCAAGGAG
AGTTTCCCTCGGGACATCCCGATGCCGCCGACGTCGCGCCTACCGGCCGAGTTCGAGTGTCAGCTCTGCTTCCAG
CGAAAGAGGTTCCAGAAGCCGTCGGACTGGACCAAGCACGTGCACGAGGACGTCCAACCCTTCACCTGCACCTGG
GATAAGTGTCGGGACGCCAAGATGTTCAAGCGCAAGGCCGACTGGGTCCGGCACGAGAACGAGGGTCACCGGCAT
CTGGAGTGGTGGACGTGCGACGTTGAAGACTGCCGACACACGTGCTACCGGCGGGACAACTTCCTGCAGCACCTG
GTGCGAGAGCACAAGTTCGTCGAGCCCAAGATCAAGACCAAGGCGGCCATGAAGCGGTCCGGCGGTCTGGACCCG
ACCTGGGTCAGGGTCGAGCAGTGCCACATCGAGACGTCGACGCGGCCGCAGGATGAGCCGTGCCGGTTCTGCGGC
AAGGCCTTCCCGACGTGGAAGAAGCTGACGGTACACCTGGCCAAGCACATGGAGCAGATCGCGCTGCCCGTGCTG
CGTCTGGTGGCGGCCAGGGAGCTCACGGCGGAGACGGTCGTCAGCCCCGTGCAGGACCTGGCGCCGCGGCCCATG
ATTCCTCTTCCCGAGCAGCCGCCGCCTGGAGCACGATTTCCCGTTGCGGCACAGTGGCAGCACCAGCAACAGGCG
TCTCTGCACGGCTACCGCCAGCCGCCGCCGTACGCGGGCCAGGGCCCTTTTATGTATTCTCTGCCGACGCCGGAA
CAGACGCAACATCCGTCATCGTTCTATGGACCTCAGTTTCACAACAACAGCCAAGTCCTGAAGCAACCGGCTATG
GGGCTCGAAGGGATGAATCAGGGGTATGAGACGAATCCTCAGCGGGTCCGAGCCATGTCCGGGTCGTCGCATGCG
TTTGCGCAGGCGCCAAGCGCGTACATGGTGCCCAACAGCAGCAGCAAGGAGGCGCCGGCGCCGGCGGAGCCGTTC
CGGCAGGTCAACGGGCTGGGCCTCCAGAACGTCGGAGACGGGTCGCTGGGCGGGGGCATGGTGAGCTACGAGACA
ATGATGGACCCTTGTGGCATCTACGGAAGCCCCTTTAGCGGTCGCGGATCTCTGTCTACCCCGGCCTCGACCTTC
TCTCCCTCCTTCCAGAACGGCAGGGGGATGGGCAGACATGACCAGGCGTGGGACGACGGGAGGCAGGCTAAGTTT
ATGTAG
Transcript >Hirsu2|10594
ATGGCTTCTACCTTCGCTCTGGCCCCCGGGCCCTTCAAAGGCCAGGAGCCCGACGGTCGCCACCTCAACCCGCCC
GCCTTCGTCCCTCAGCGCCTCCCGCCTACAGTGGCTGGCGACCAGGTTTTTCATTGCGTCTCCTTGTCGCCCGCT
GCACCCCAATTCGAGACGCCCCTCACCGCCTGCTCCAACCTCAGCACCAACCTCAGCCAATACCAACCCAGCGAC
TTCAGTGACTTCGACGAGGATCCCTTCTTCGGAGCCAGCTTAGACCTCCTCGACGACGCCGCTGACTTACATGAC
CCCCTCGCTCTGCGCGCCAAGGGAGTCGCCGCTACGGTCACAACCACGGCCAAAACCATGGCGAAGCAACCTCAC
GATAACCGCGACGGCGCATCCTACCCTCTGACCCCAACCCACACTGCTTCCGTCCACACCACAACGCCCACGAGC
GAGCCCAGGGGCTCCATAGCACCTTTGTCGGCCGACGACATCCCGGACTCCATCTCTCCCGAGGAGCTCCAGATG
CCCTTCCACCCCCCCCACGCCGTCGTCCAGCCGTCCGACCTCACTTCCAGCCACGCCGGCAGTCATCGCAACAGC
GAGGACAGCCTGGCCCCGCGCCCCGTCGCCGTCAATCCTCAGAGCCCGAGGGTCACCGTCTCCGTGTGGGACAAG
AGTGACGGCCCGCGGGTCGATGCCGTCGCACGGACCTTTGACGAGGATGGCCAATGCGCCGCACGGAGCGACCTC
CGTTCTGCCGGCGATCTCATCTCCTCGGCCCATCGCCCGCACTTCTCCGCCGCCGCCCCGGATGCGCCCGGAAGC
TGGCACCAGACCTCGCCCCCACACCGCATCGGCCTCGATCCCCGCCACCGTCCTATCGACGAGGTCCCCAGTATC
AACGAGGTGGCGACGCGGCGAAACGCCCAACGGCGCAACCGGGATGTCAGCAATTGGCTCGCCAACCAGCTCGAC
GAGTCCTCAGCGCCCCAGGACACGAGCTCCCACGACATGTGCGCCATGGAGAAGCTCCGCCAGGACACACAAGAC
GGCATTCCTCTCGGCGACCAGACGGAAAACCGATTCGTTCCCGGCCAGACCTACTACAACGAGGCGGGCGGCGGC
CCCCTGACGCAGGAGGACCGGGAAATCATCGCCGAGGACCACAAATGGGCTGATGCCCCCATGCTGCAGCACATT
GCCTTGAGCCCAGGTCGTGCTACCCAGCCGCAATCCTCTCAAGCTGCCATCGAGCGGTTTGAGAGGCTGTGCCGT
GACAACGACTCCATCCTCTCGAGGTCCGCCACCTGGGGAACCCGTCGGCGGAGTCACCCCAGCGTCTTGGATGCC
GACATCGAAAACGTCACGGGCGGCAACTTCTTGAAGAAGCTGACGATTGGTCGCGGAAGCGGCGACAAGGGCAGC
AGCAGGTCCGGGGGGCTACTGAAAGATCTTCGGGGGCTCGTCAGGCGGCCCAGCGCCAGTTCCCTGCGCAAGCGC
GCCCGCAGCCGCTCCCACGGAACCGCCGATGAGGAGCCCGCAGAGCAGCCGTCCGGAGGGGAGCAGCCGCAGCGG
GGCAAGCGTGATTCCACACCCCATCTGTCTCCCACGCCGCGTTCGCCGAGCTGGGGGCGGAAGCCCACGCCCAGC
CTGAACACGGCGTTGGTTTCTATGGCCCAGAGCATCGTTAACATCGGGACCGCCGTCCCGCGCAGCGGCGGCTCC
TCGCCCATGCCCTCTCCCAGGATCGGCCTGAGCATGAGGAACACGCTCAGGCGGCCTCGCAGCAAGTCTGAGGTC
CCCAAAGCATCCGCCACGTCGGCCGGCGTGCCGGCCGAGAGCCACCCGAACCTTATTGAGATGTGGAAGAAGACG
GGCGGCCCGCCGGTGACGCCCCTGGGTAAGACGATGAACCTCGGCGGCGGCGGCGGCTGGGCAGCAGGAGGGGGG
CCCGACGACGATGACGACGATGACGACGACGACTTTGACGAAGACAACGACATGAGGACGAACCCCAACATCATC
GACAGCCTCTCGCCCGATTTTGCAGGCTTCCAGCAGCACCTGCTGACGCTGAATCCTGGCCTCGACCTGTCACAC
GGCTACCTGGTCGAGCGCATCTCGCAGCAGCAGGTGATACGATACAAGCAGCTGCTCAACACCAAGATCAAGCAC
CTCGGCCTCGGCGGCGGCTGCCCATGCGGCCCGCTGTGCGTGGCCCTGGGCGGCTCGGCCAACGTGCTCGACCAC
CAGAAGAGCGATGGGCAGGAGGCGAACGAGGCGGCCGACGACGGTGTCCCGGCCGAGGGCGTCATCGGCAAGGAG
AGTTTCCCTCGGGACATCCCGATGCCGCCGACGTCGCGCCTACCGGCCGAGTTCGAGTGTCAGCTCTGCTTCCAG
CGAAAGAGGTTCCAGAAGCCGTCGGACTGGACCAAGCACGTGCACGAGGACGTCCAACCCTTCACCTGCACCTGG
GATAAGTGTCGGGACGCCAAGATGTTCAAGCGCAAGGCCGACTGGGTCCGGCACGAGAACGAGGGTCACCGGCAT
CTGGAGTGGTGGACGTGCGACGTTGAAGACTGCCGACACACGTGCTACCGGCGGGACAACTTCCTGCAGCACCTG
GTGCGAGAGCACAAGTTCGTCGAGCCCAAGATCAAGACCAAGGCGGCCATGAAGCGGTCCGGCGGTCTGGACCCG
ACCTGGGTCAGGGTCGAGCAGTGCCACATCGAGACGTCGACGCGGCCGCAGGATGAGCCGTGCCGGTTCTGCGGC
AAGGCCTTCCCGACGTGGAAGAAGCTGACGGTACACCTGGCCAAGCACATGGAGCAGATCGCGCTGCCCGTGCTG
CGTCTGGTGGCGGCCAGGGAGCTCACGGCGGAGACGGTCGTCAGCCCCGTGCAGGACCTGGCGCCGCGGCCCATG
ATTCCTCTTCCCGAGCAGCCGCCGCCTGGAGCACGATTTCCCGTTGCGGCACAGTGGCAGCACCAGCAACAGGCG
TCTCTGCACGGCTACCGCCAGCCGCCGCCGTACGCGGGCCAGGGCCCTTTTATGTATTCTCTGCCGACGCCGGAA
CAGACGCAACATCCGTCATCGTTCTATGGACCTCAGTTTCACAACAACAGCCAAGTCCTGAAGCAACCGGCTATG
GGGCTCGAAGGGATGAATCAGGGGTATGAGACGAATCCTCAGCGGGTCCGAGCCATGTCCGGGTCGTCGCATGCG
TTTGCGCAGGCGCCAAGCGCGTACATGGTGCCCAACAGCAGCAGCAAGGAGGCGCCGGCGCCGGCGGAGCCGTTC
CGGCAGGTCAACGGGCTGGGCCTCCAGAACGTCGGAGACGGGTCGCTGGGCGGGGGCATGGTGAGCTACGAGACA
ATGATGGACCCTTGTGGCATCTACGGAAGCCCCTTTAGCGGTCGCGGATCTCTGTCTACCCCGGCCTCGACCTTC
TCTCCCTCCTTCCAGAACGGCAGGGGGATGGGCAGACATGACCAGGCGTGGGACGACGGGAGGCAGGCTAAGTTT
ATGTAG
Gene >Hirsu2|10594
ATGGCTTCTACCTTCGCTCTGGCCCCCGGGCCCTTCAAAGGCCAGGAGCCCGACGGTCGCCACCTCAACCCGCCC
GCCTTCGTCCCTCAGCGCCTCCCGCCTACAGTGGCTGGCGACCAGGTTTTTCATTGCGTCTCCTTGTCGCCCGCT
GCACCCCAATTCGAGACGCCCCTCACCGCCTGCTCCAACCTCAGCACCAACCTCAGCCAATACCAACCCAGCGAC
TTCAGTGACTTCGACGAGGATCCCTTCTTCGGAGCCAGCTTAGACCTCCTCGACGACGCCGCTGACTTACATGAC
CCCCTCGCTCTGCGCGCCAAGGGAGTCGCCGCTACGGTCACAACCACGGCCAAAACCATGGCGAAGCAACCTCAC
GATAACCGCGACGGCGCATCCTACCCTCTGACCCCAACCCACACTGCTTCCGTCCACACCACAACGCCCACGAGC
GAGCCCAGGGGCTCCATAGCACCTTTGTCGGCCGACGACATCCCGGACTCCATCTCTCCCGAGGAGCTCCAGATG
CCCTTCCACCCCCCCCACGCCGTCGTCCAGCCGTCCGACCTCACTTCCAGCCACGCCGGCAGTCATCGCAACAGC
GAGGACAGCCTGGCCCCGCGCCCCGTCGCCGTCAATCCTCAGAGCCCGAGGGTCACCGTCTCCGTGTGGGACAAG
AGTGACGGCCCGCGGGTCGATGCCGTCGCACGGACCTTTGACGAGGATGGCCAATGCGCCGCACGGAGCGACCTC
CGTTCTGCCGGCGATCTCATCTCCTCGGCCCATCGCCCGCACTTCTCCGCCGCCGCCCCGGATGCGCCCGGAAGC
TGGCACCAGACCTCGCCCCCACACCGCATCGGCCTCGATCCCCGCCACCGTCCTATCGACGAGGTCCCCAGTATC
AACGAGGTGGCGACGCGGCGAAACGCCCAACGGCGCAACCGGGATGTCAGCAATTGGCTCGCCAACCAGCTCGAC
GAGTCCTCAGCGCCCCAGGACACGAGCTCCCACGACATGTGCGCCATGGAGAAGCTCCGCCAGGACACACAAGAC
GGCATTCCTCTCGGCGACCAGACGGAAAACCGATTCGTTCCCGGCCAGACCTACTACAACGAGGCGGGCGGCGGC
CCCCTGACGCAGGAGGACCGGGAAATCATCGCCGAGGACCACAAATGGGCTGATGCCCCCATGCTGCAGCACATT
GCCTTGAGCCCAGGTCGTGCTACCCAGCCGCAATCCTCTCAAGCTGCCATCGAGCGGTTTGAGAGGCTGTGCCGT
GACAACGACTCCATCCTCTCGAGGTCCGCCACCTGGGGAACCCGTCGGCGGAGTCACCCCAGCGTCTTGGATGCC
GACATCGAAAACGTCACGGGCGGCAACTTCTTGAAGAAGCTGACGATTGGTCGCGGAAGCGGCGACAAGGGCAGC
AGCAGGTCCGGGGGGCTACTGAAAGATCTTCGGGGGCTCGTCAGGCGGCCCAGCGCCAGTTCCCTGCGCAAGCGC
GCCCGCAGCCGCTCCCACGGAACCGCCGATGAGGAGCCCGCAGAGCAGCCGTCCGGAGGGGAGCAGCCGCAGCGG
GGCAAGCGTGATTCCACACCCCATCTGTCTCCCACGCCGCGTTCGCCGAGCTGGGGGCGGAAGCCCACGCCCAGC
CTGAACACGGCGTTGGTTTCTATGGCCCAGAGCATCGTTAACATCGGGACCGCCGTCCCGCGCAGCGGCGGCTCC
TCGCCCATGCCCTCTCCCAGGATCGGCCTGAGCATGAGGAACACGCTCAGGCGGCCTCGCAGCAAGTCTGAGGTC
CCCAAAGCATCCGCCACGTCGGCCGGCGTGCCGGCCGAGAGCCACCCGAACCTTATTGAGATGTGGAAGAAGACG
GGCGGCCCGCCGGTGACGCCCCTGGGTAAGACGATGAACCTCGGCGGCGGCGGCGGCTGGGCAGCAGGAGGGGGG
CCCGACGACGATGACGACGATGACGACGACGACTTTGACGAAGACAACGACATGAGGACGAACCCCAACATCATC
GACAGCCTCTCGCCCGATTTTGCAGGCTTCCAGCAGCACCTGCTGACGCTGAATCCTGGCCTCGACCTGTCACAC
GGCTACCTGGTCGAGCGCATCTCGCAGCAGCAGGTGATACGATACAAGCAGCTGCTCAACACCAAGATCAAGCAC
CTCGGCCTCGGCGGCGGCTGCCCATGCGGCCCGCTGTGCGTGGCCCTGGGCGGCTCGGCCAACGTGCTCGACCAC
CAGAAGAGCGATGGGCAGGAGGCGAACGAGGCGGCCGACGACGGTGTCCCGGCCGAGGGCGTCATCGGCAAGGAG
AGTTTCCCTCGGGACATCCCGATGCCGCCGACGTCGCGCCTACCGGCCGAGTTCGAGTGTCAGCTCTGCTTCCAG
CGAAAGAGGTTCCAGAAGCCGTCGGACTGGACCAAGCACGTGCACGAGGACGTCCAACCCTTCACCTGCACCTGG
GATAAGTGTCGGGACGCCAAGATGTTCAAGCGCAAGGCCGACTGGGTCCGGCACGAGAACGAGGGTCACCGGCAT
CTGGAGTGGTGGACGTGCGACGTTGAAGACTGCCGACACACGTGCTACCGGCGGGACAACTTCCTGCAGCACCTG
GTGCGAGAGCACAAGTTCGTCGAGCCCAAGATCAAGACCAAGGCGGCCATGAAGCGGTCCGGCGGTCTGGACCCG
ACCTGGGTCAGGGTCGAGCAGTGCCACATCGAGACGTCGACGCGGCCGCAGGATGAGCCGTGCCGGTTCTGCGGC
AAGGCCTTCCCGACGTGGAAGAAGCTGACGGTACACCTGGCCAAGCACATGGAGCAGATCGCGCTGCCCGTGCTG
CGTCTGGTGGCGGCCAGGGAGCTCACGGCGGAGACGGTCGTCAGCCCCGTGCAGGACCTGGCGCCGCGGCCCATG
ATTCCTCTTCCCGAGCAGCCGCCGCCTGGAGCACGATTTCCCGTTGCGGCACAGTGGCAGCACCAGCAACAGGCG
TCTCTGCACGGCTACCGCCAGCCGCCGCCGTACGCGGGCCAGGGCCCTTTTATGTATTCTCTGCCGACGCCGGAA
CAGACGCAACATCCGTCATCGTTCTATGGACCTCAGTTTCACAACAACAGCCAAGTCCTGAAGCAACCGGCTATG
GGGCTCGAAGGGATGAATCAGGGGTATGAGACGAATCCTCAGCGGGTCCGAGCCATGTCCGGGTCGTCGCATGCG
TTTGCGCAGGCGCCAAGCGCGTACATGGTGCCCAACAGCAGCAGCAAGGAGGCGCCGGCGCCGGCGGAGCCGTTC
CGGCAGGTCAACGGGCTGGGCCTCCAGAACGTCGGAGACGGGTCGCTGGGCGGGGGCATGGTGAGCTACGAGACA
ATGATGGACCCTTGTGGCATCTACGGAAGCCCCTTTAGCGGTCGCGGATCTCTGTCTACCCCGGCCTCGACCTTC
TCTCCCTCCTTCCAGAACGGCAGGGGGATGGGCAGACATGACCAGGCGTGGGACGACGGGAGGCAGGCTAAGTTT
ATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail