Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10591
Gene name
LocationContig_872:862..3147
Strand-
Gene length (bp)2285
Transcript length (bp)2223
Coding sequence length (bp)2223
Protein length (aa) 741

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 4.9E-144 171 627
PF14558 TRP_N ML-like domain 7.1E-38 28 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 4 698 2.0E-43
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 8 633 3.0E-41
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 36 600 4.0E-38
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 22 553 2.0E-35
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 28 599 8.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 4 698 2.0E-43
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 8 633 3.0E-41
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 36 600 4.0E-38
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 22 553 2.0E-35
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 28 599 8.0E-34
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 21 565 2.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 173 195 22
2 351 373 22
3 404 426 22
4 430 452 22
5 491 513 22
6 517 539 22
7 546 568 22
8 583 605 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10591
MPRRHPPSWRSALLVGFLAATARAADILKTDGFSDCGTDDSIKVDKVDIAYDKETKSVTFDVAGSSLKEQNVTAV
LDVTAYGSSVYSNSFNPCDKDTFVQRLCPVPKGTFAAQGSRQIPAQFADMVPAIAFQVPDIAAQATLQLKSLDGG
NNVACIRSQVSNGKTTSSQAIQYVAAGVAGVALVVSGISSVGAVLSGGGAAGSGGGLGTVSPTFTETFGWFQGMA
LNGMFSVRYPPVYRSFSKNLAFSVGIFEWYGVQKSIDGFRAGTGGNLTEDNVDFLRNATLVFPDGSTSSPSASQG
PLRIKRSLDDFALLVARDDADSSNQTSAQFQHVVQGIQAYAAKLAVPKSDVFMTALLVVAIVIAAIVVGILLVKV
VLEAWAVFGSFPKSLAGFRKHYWGSIARTITSLILILYGIWVLYCIFQFTHGDSWAAKTLAGVTLALFTAILAFF
TWKIWSTARRLKREGGDADGLYDDKQIWVKYSLFYESYKKNYWWLFVPTIVYMFVKGATLAATDGSGMVQTIAQL
VIEAVMLGLLLWSRPYERRSGNVINITIAVVRVLSVVCILVFVEEFGIRQTTQTVAGVVLIAVQSALTGVLAILI
AWNAIYACCKVNPHRKRRKDMEKMQRDMDTLTPLDARNSLLLDHHPRIGPNMSVHSFPSHFKEKATLSPNASERY
YHVEKGFGPLYRAQTPTTPSDVTRNLVDHAAPMGMDAYDSRPPNLERDYRGPLGPSYGYGQGGWR*
Coding >Hirsu2|10591
ATGCCTCGCCGACATCCTCCCTCATGGCGCTCCGCCCTGCTCGTCGGCTTCCTGGCCGCCACGGCACGCGCCGCC
GACATCCTCAAGACCGACGGCTTCAGCGACTGCGGCACCGACGATAGCATCAAGGTTGACAAGGTCGACATCGCC
TACGACAAGGAAACCAAGTCCGTCACCTTCGATGTCGCCGGCTCCAGCCTCAAGGAGCAAAACGTCACCGCCGTC
CTCGACGTCACCGCCTACGGCTCCTCCGTCTACTCCAACAGCTTCAACCCCTGTGACAAGGACACCTTCGTCCAG
CGTCTGTGTCCCGTCCCCAAGGGCACCTTCGCCGCCCAGGGCTCTCGCCAGATCCCCGCCCAGTTCGCCGACATG
GTGCCCGCCATCGCCTTCCAGGTCCCCGACATTGCCGCCCAGGCCACCCTGCAACTCAAGAGCCTCGATGGCGGC
AACAACGTGGCCTGCATTCGCTCCCAGGTCTCCAATGGCAAGACCACCAGCAGCCAGGCGATTCAGTACGTTGCC
GCCGGCGTCGCCGGCGTCGCCCTCGTCGTCTCCGGCATCTCCTCCGTCGGCGCCGTCCTTTCCGGGGGCGGCGCC
GCCGGCTCGGGCGGAGGCCTCGGCACCGTCAGTCCCACCTTCACCGAGACATTCGGCTGGTTCCAGGGCATGGCC
CTGAACGGCATGTTCTCCGTCCGCTACCCCCCCGTCTACCGCAGCTTCTCCAAGAATCTGGCCTTCTCCGTCGGC
ATCTTCGAGTGGTACGGCGTCCAGAAGTCCATCGACGGCTTCCGCGCCGGCACCGGCGGCAACCTCACCGAGGAC
AACGTCGACTTCCTCCGCAACGCCACCCTCGTCTTCCCCGATGGCTCCACCTCCAGTCCGTCGGCCAGTCAGGGC
CCCCTCCGGATCAAGCGCTCCCTCGACGACTTCGCCCTCCTGGTCGCCCGCGACGATGCCGACTCGTCCAACCAG
ACGTCGGCCCAGTTCCAGCATGTCGTCCAGGGCATCCAGGCCTACGCCGCCAAGCTCGCCGTCCCCAAGTCGGAC
GTCTTCATGACGGCCCTGCTCGTCGTCGCCATAGTCATCGCCGCCATCGTCGTCGGCATCCTGCTCGTCAAGGTG
GTGCTCGAGGCCTGGGCCGTCTTCGGCAGCTTCCCCAAGTCGCTCGCCGGCTTCCGCAAGCACTACTGGGGGTCC
ATCGCCCGCACCATTACCTCCCTCATCCTCATTCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACC
CACGGCGACTCGTGGGCCGCCAAGACGCTCGCCGGTGTCACCCTCGCCCTCTTCACCGCCATCCTCGCCTTCTTC
ACCTGGAAGATTTGGAGCACGGCCCGGCGCCTCAAGCGCGAGGGCGGCGACGCCGACGGCCTCTACGACGACAAG
CAGATCTGGGTCAAGTATTCGCTCTTCTACGAGTCGTACAAGAAGAACTACTGGTGGCTCTTTGTTCCGACCATC
GTCTACATGTTCGTCAAGGGCGCCACCCTGGCCGCCACGGACGGCAGCGGCATGGTCCAGACCATCGCCCAGCTC
GTCATCGAGGCCGTCATGCTGGGCCTGCTGCTGTGGAGCCGCCCCTACGAGCGCAGGTCGGGCAACGTCATCAAT
ATCACCATCGCCGTCGTCCGCGTCCTGTCTGTCGTCTGCATCCTCGTCTTCGTCGAGGAGTTTGGCATCAGGCAG
ACGACGCAGACCGTCGCCGGTGTCGTCTTGATCGCCGTCCAGTCGGCCCTCACTGGCGTCCTCGCCATCCTCATC
GCCTGGAACGCCATCTATGCCTGTTGCAAGGTGAACCCGCACCGGAAGCGCAGGAAGGACATGGAGAAAATGCAG
CGCGACATGGACACGCTCACGCCTCTGGACGCGCGCAACTCGCTGCTTCTCGATCACCACCCCCGCATCGGTCCC
AACATGTCGGTGCACTCCTTCCCGAGCCACTTCAAAGAGAAGGCGACGCTGTCCCCGAACGCATCGGAACGATAT
TACCACGTCGAAAAGGGTTTCGGACCCCTGTACAGGGCCCAGACGCCGACGACGCCCAGCGACGTAACGCGGAAT
CTGGTGGACCACGCGGCCCCCATGGGGATGGACGCATACGACTCGAGGCCCCCCAACCTAGAGCGAGATTACAGG
GGACCCCTGGGGCCGAGCTACGGTTACGGGCAGGGAGGCTGGAGATGA
Transcript >Hirsu2|10591
ATGCCTCGCCGACATCCTCCCTCATGGCGCTCCGCCCTGCTCGTCGGCTTCCTGGCCGCCACGGCACGCGCCGCC
GACATCCTCAAGACCGACGGCTTCAGCGACTGCGGCACCGACGATAGCATCAAGGTTGACAAGGTCGACATCGCC
TACGACAAGGAAACCAAGTCCGTCACCTTCGATGTCGCCGGCTCCAGCCTCAAGGAGCAAAACGTCACCGCCGTC
CTCGACGTCACCGCCTACGGCTCCTCCGTCTACTCCAACAGCTTCAACCCCTGTGACAAGGACACCTTCGTCCAG
CGTCTGTGTCCCGTCCCCAAGGGCACCTTCGCCGCCCAGGGCTCTCGCCAGATCCCCGCCCAGTTCGCCGACATG
GTGCCCGCCATCGCCTTCCAGGTCCCCGACATTGCCGCCCAGGCCACCCTGCAACTCAAGAGCCTCGATGGCGGC
AACAACGTGGCCTGCATTCGCTCCCAGGTCTCCAATGGCAAGACCACCAGCAGCCAGGCGATTCAGTACGTTGCC
GCCGGCGTCGCCGGCGTCGCCCTCGTCGTCTCCGGCATCTCCTCCGTCGGCGCCGTCCTTTCCGGGGGCGGCGCC
GCCGGCTCGGGCGGAGGCCTCGGCACCGTCAGTCCCACCTTCACCGAGACATTCGGCTGGTTCCAGGGCATGGCC
CTGAACGGCATGTTCTCCGTCCGCTACCCCCCCGTCTACCGCAGCTTCTCCAAGAATCTGGCCTTCTCCGTCGGC
ATCTTCGAGTGGTACGGCGTCCAGAAGTCCATCGACGGCTTCCGCGCCGGCACCGGCGGCAACCTCACCGAGGAC
AACGTCGACTTCCTCCGCAACGCCACCCTCGTCTTCCCCGATGGCTCCACCTCCAGTCCGTCGGCCAGTCAGGGC
CCCCTCCGGATCAAGCGCTCCCTCGACGACTTCGCCCTCCTGGTCGCCCGCGACGATGCCGACTCGTCCAACCAG
ACGTCGGCCCAGTTCCAGCATGTCGTCCAGGGCATCCAGGCCTACGCCGCCAAGCTCGCCGTCCCCAAGTCGGAC
GTCTTCATGACGGCCCTGCTCGTCGTCGCCATAGTCATCGCCGCCATCGTCGTCGGCATCCTGCTCGTCAAGGTG
GTGCTCGAGGCCTGGGCCGTCTTCGGCAGCTTCCCCAAGTCGCTCGCCGGCTTCCGCAAGCACTACTGGGGGTCC
ATCGCCCGCACCATTACCTCCCTCATCCTCATTCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACC
CACGGCGACTCGTGGGCCGCCAAGACGCTCGCCGGTGTCACCCTCGCCCTCTTCACCGCCATCCTCGCCTTCTTC
ACCTGGAAGATTTGGAGCACGGCCCGGCGCCTCAAGCGCGAGGGCGGCGACGCCGACGGCCTCTACGACGACAAG
CAGATCTGGGTCAAGTATTCGCTCTTCTACGAGTCGTACAAGAAGAACTACTGGTGGCTCTTTGTTCCGACCATC
GTCTACATGTTCGTCAAGGGCGCCACCCTGGCCGCCACGGACGGCAGCGGCATGGTCCAGACCATCGCCCAGCTC
GTCATCGAGGCCGTCATGCTGGGCCTGCTGCTGTGGAGCCGCCCCTACGAGCGCAGGTCGGGCAACGTCATCAAT
ATCACCATCGCCGTCGTCCGCGTCCTGTCTGTCGTCTGCATCCTCGTCTTCGTCGAGGAGTTTGGCATCAGGCAG
ACGACGCAGACCGTCGCCGGTGTCGTCTTGATCGCCGTCCAGTCGGCCCTCACTGGCGTCCTCGCCATCCTCATC
GCCTGGAACGCCATCTATGCCTGTTGCAAGGTGAACCCGCACCGGAAGCGCAGGAAGGACATGGAGAAAATGCAG
CGCGACATGGACACGCTCACGCCTCTGGACGCGCGCAACTCGCTGCTTCTCGATCACCACCCCCGCATCGGTCCC
AACATGTCGGTGCACTCCTTCCCGAGCCACTTCAAAGAGAAGGCGACGCTGTCCCCGAACGCATCGGAACGATAT
TACCACGTCGAAAAGGGTTTCGGACCCCTGTACAGGGCCCAGACGCCGACGACGCCCAGCGACGTAACGCGGAAT
CTGGTGGACCACGCGGCCCCCATGGGGATGGACGCATACGACTCGAGGCCCCCCAACCTAGAGCGAGATTACAGG
GGACCCCTGGGGCCGAGCTACGGTTACGGGCAGGGAGGCTGGAGATGA
Gene >Hirsu2|10591
ATGCCTCGCCGACATCCTCCCTCATGGCGCTCCGCCCTGCTCGTCGGCTTCCTGGCCGCCACGGCACGCGCCGCC
GACATCCTCAAGACCGACGGCTTCAGCGACTGCGGCACCGACGATAGCATCAAGGTTGACAAGGTCGACATCGCC
TACGACAAGGAAACCAAGTCCGTCACCTTCGATGTCGCCGGCTCCAGCCTCAAGGAGCAAAACGTCACCGCCGTC
CTCGACGTCACCGCCTACGGCTCCTCCGTCTACTCCAACAGCTTCAACCCCTGTGACAAGGACACCTTCGTCCAG
CGTCTGTGTCCCGTCCCCAAGGGCACCTTCGCCGCCCAGGGCTCTCGCCAGATCCCCGCCCAGTTCGCCGACATG
GTGCCCGCCATCGCCTTCCAGGTCCCCGACATTGCCGCCCAGGCCACCCTGCAACTCAAGAGCCTCGATGGCGGC
AACAACGTGGCCTGCATTCGCTCCCAGGTCTCCAATGGCAAGACCACCAGCAGCCAGGCGATTCAGTACGTTGCC
GCCGGCGTCGCCGGCGTCGCCCTCGTCGTCTCCGGCATCTCCTCCGTCGGCGCCGTCCTTTCCGGGGGCGGCGCC
GCCGGCTCGGGCGGAGGCCTCGGCACCGTCAGTCCCACCTTCACCGAGACATTCGGCTGGTTCCAGGGCATGGCC
CTGAACGGCATGTTCTCCGTCCGCTACCCCCCCGTCTACCGCAGCTTCTCCAAGAATCTGGCCTTCTCCGTCGGC
ATCTTCGAGTGGTACGGCGTCCAGAAGTCCATCGACGGCTTCCGCGCCGGCACCGGCGGCAACCTCACCGAGGAC
AACGTCGACTTCCTCCGCAACGCCACCCTCGTCTTCCCCGATGGCTCCACCTCCAGTCCGTCGGCCAGTCAGGGC
CCCCTCCGGATCAAGCGCTCCCTCGACGACTTCGCCCTCCTGGTCGCCCGCGACGATGCCGACTCGTCCAACCAG
ACGTCGGCCCAGTTCCAGCATGTCGTCCAGGGCATCCAGGCCTACGCCGCCAAGCTCGCCGTCCCCAAGTCGGAC
GTCTTCATGACGGCCCTGCTCGTCGTCGCCATAGTCATCGCCGCCATCGTCGTCGGCATCCTGCTCGTCAAGGTG
GTGCTCGAGGCCTGGGCCGTCTTCGGCAGCTTCCCCAAGTCGCTCGCCGGCTTCCGCAAGCACTACTGGGGGTCC
ATCGCCCGCACCATTACCTCCCTCATCCTCATTCTCTACGGCATCTGGGTCCTCTACTGCATCTTCCAGTTCACC
CACGGCGACTCGTGGGCCGCCAAGACGCTCGCCGGTGTCACCCTCGCCCTCTTCACCGCCATCCTCGCCTTCTTC
ACCTGGAAGATTTGGAGCACGGCCCGGCGCCTCAAGCGCGAGGGCGGCGACGCCGACGGCCTCTACGACGACAAG
CAGATCTGGGTCAAGTATTCGCTCTTCTACGAGTCGTACAAGAAGAACTACTGGTGGCTCTTTGTTCCGACCATC
GTCTACATGTTCGTCAAGGGCGCCACCCTGGCCGCCACGGACGGCAGCGGCATGGTCCAGACCATCGCCCAGCTC
GTCATCGAGGCCGTCATGCTGGGCCTGCTGCTGTGGAGCCGCCCCTACGAGCGCAGGTCGGGCAACGTCATCAAT
ATCACCATCGCCGTCGTCCGCGTCCTGTCTGTCGTCTGCATCCTCGTCTTCGTCGAGGAGTTTGGCATCAGGCAG
ACGACGCAGACCGTCGCCGGTGTCGTCTTGATCGCCGTCCAGTCGGCCCTCACTGGCGTCCTCGCCATCCTCATC
GCCTGGAACGCCATCTATGCCTGTTGCAAGGTGAACCCGCACCGGAAGCGCAGGAAGGACATGGGTAAGTCCGAG
ACCCCCCATTTCGCCCTGACCGGAAACCCAGTGACTCACGCTGCCCGGCAGAGAAAATGCAGCGCGACATGGACA
CGCTCACGCCTCTGGACGCGCGCAACTCGCTGCTTCTCGATCACCACCCCCGCATCGGTCCCAACATGTCGGTGC
ACTCCTTCCCGAGCCACTTCAAAGAGAAGGCGACGCTGTCCCCGAACGCATCGGAACGATATTACCACGTCGAAA
AGGGTTTCGGACCCCTGTACAGGGCCCAGACGCCGACGACGCCCAGCGACGTAACGCGGAATCTGGTGGACCACG
CGGCCCCCATGGGGATGGACGCATACGACTCGAGGCCCCCCAACCTAGAGCGAGATTACAGGGGACCCCTGGGGC
CGAGCTACGGTTACGGGCAGGGAGGCTGGAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail