Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1059
Gene name
LocationContig_122:5521..6482
Strand-
Gene length (bp)961
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain 5.9E-07 105 154

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94519|SPF30_SCHPO Splicing factor spf30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf30 PE=1 SV=1 7 156 1.0E-10
sp|Q7ZV80|SPF30_DANRE Survival of motor neuron-related-splicing factor 30 OS=Danio rerio GN=smndc1 PE=2 SV=1 14 261 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1059
MSTVAAIEEEKKQYQEQLDIVRGQLRDDRNNAELTALEEELNNVIGLLDENIAELQPQKQKQPEKPVEAEPAQPE
KWSRENHPAFKKAAAAEEKEELPANYQVNDTVLAKWVSGDRAFYPARITSITGSSTAPIYIVKFKSYDNTETLRS
KDIRPVSNKRKADGTPAASAPAPAATAPAPGLVSSAGATLYPEAQQDSHKEEEAPKKPKKIKAKKELEASKSKWQ
EFNAKSKISKTKKKESMFRTPEGINGRVGFTGSGQAMRKDPARVRPHYMPGDDID*
Coding >Hirsu2|1059
ATGTCGACCGTTGCCGCTATCGAGGAGGAGAAGAAGCAGTACCAGGAACAACTCGACATCGTCCGCGGCCAGCTA
CGCGACGATCGTAACAATGCCGAACTGACCGCGTTGGAAGAGGAGCTGAACAACGTCATCGGCCTCCTCGACGAG
AACATCGCCGAGCTTCAACCCCAGAAGCAGAAGCAGCCCGAGAAACCGGTCGAGGCAGAGCCCGCGCAGCCCGAA
AAGTGGTCTCGAGAGAATCACCCGGCCTTTAAGAAGGCAGCGGCTGCGGAGGAAAAGGAAGAACTCCCCGCCAAC
TACCAAGTCAACGATACCGTCCTGGCAAAATGGGTCTCGGGCGACCGGGCTTTCTATCCCGCCAGAATCACCTCC
ATCACCGGCTCTTCTACGGCTCCCATATACATCGTCAAATTTAAGAGTTACGATAACACCGAGACTCTCAGGTCC
AAAGATATCCGACCCGTCTCCAACAAACGAAAGGCAGACGGCACCCCCGCGGCATCCGCTCCGGCTCCTGCCGCC
ACCGCTCCCGCCCCGGGACTGGTCTCATCCGCCGGTGCCACCTTGTATCCCGAGGCACAGCAGGATAGCCACAAG
GAGGAGGAGGCTCCCAAGAAGCCCAAGAAAATCAAGGCAAAGAAGGAGCTCGAGGCCAGCAAGTCCAAGTGGCAG
GAATTCAACGCCAAATCCAAGATTTCCAAAACGAAGAAGAAGGAGAGCATGTTTCGCACTCCCGAGGGCATCAAC
GGCAGAGTCGGCTTCACGGGGTCGGGACAGGCCATGCGCAAGGATCCTGCTCGAGTTCGGCCCCACTACATGCCC
GGTGACGACATCGACTAA
Transcript >Hirsu2|1059
ATGTCGACCGTTGCCGCTATCGAGGAGGAGAAGAAGCAGTACCAGGAACAACTCGACATCGTCCGCGGCCAGCTA
CGCGACGATCGTAACAATGCCGAACTGACCGCGTTGGAAGAGGAGCTGAACAACGTCATCGGCCTCCTCGACGAG
AACATCGCCGAGCTTCAACCCCAGAAGCAGAAGCAGCCCGAGAAACCGGTCGAGGCAGAGCCCGCGCAGCCCGAA
AAGTGGTCTCGAGAGAATCACCCGGCCTTTAAGAAGGCAGCGGCTGCGGAGGAAAAGGAAGAACTCCCCGCCAAC
TACCAAGTCAACGATACCGTCCTGGCAAAATGGGTCTCGGGCGACCGGGCTTTCTATCCCGCCAGAATCACCTCC
ATCACCGGCTCTTCTACGGCTCCCATATACATCGTCAAATTTAAGAGTTACGATAACACCGAGACTCTCAGGTCC
AAAGATATCCGACCCGTCTCCAACAAACGAAAGGCAGACGGCACCCCCGCGGCATCCGCTCCGGCTCCTGCCGCC
ACCGCTCCCGCCCCGGGACTGGTCTCATCCGCCGGTGCCACCTTGTATCCCGAGGCACAGCAGGATAGCCACAAG
GAGGAGGAGGCTCCCAAGAAGCCCAAGAAAATCAAGGCAAAGAAGGAGCTCGAGGCCAGCAAGTCCAAGTGGCAG
GAATTCAACGCCAAATCCAAGATTTCCAAAACGAAGAAGAAGGAGAGCATGTTTCGCACTCCCGAGGGCATCAAC
GGCAGAGTCGGCTTCACGGGGTCGGGACAGGCCATGCGCAAGGATCCTGCTCGAGTTCGGCCCCACTACATGCCC
GGTGACGACATCGACTAA
Gene >Hirsu2|1059
ATGTCGACCGTTGCCGCTATCGAGGAGGAGAAGAAGCAGTACCAGGAACAAGTAGGCGGCCGTCACGCGCCACAC
GTCGCGTTTGAGCGTCGTCGCGGCTAACCGGAAGCACCACAGCTCGACATCGTCCGCGGCCAGCTACGCGACGAT
CGTAACAATGCCGAACTGACCGCGTTGGAAGAGGAGCTGAACAACGTCATCGGCCTCCTCGACGAGAACATCGCC
GAGCTTCAACCCCAGAAGCAGAAGCAGCCCGAGAAACCGGTCGAGGCAGAGCCCGCGCAGCCCGAAAAGTGGTCT
CGAGAGAATCACCCGGCCTTTAAGAAGGCAGCGGCTGCGGAGGAAAAGGAAGAACTCCCCGCCAACTACCAAGTC
AACGATACCGTCCTGGCAAAATGGGTCTCGGGCGACCGGGCTTTCTATCCCGCCAGAATCACCTCCATCACCGGC
TCTTCTACGGCTCCCATATACATCGTCAAATTTAAGAGTTACGATAACACCGAGACTCTCAGGTCCAAAGATATC
CGACCCGTCTCCAACAAACGAAAGGCAGACGGCACCCCCGCGGCATCCGCTCCGGCTCCTGCCGCCACCGCTCCC
GCCCCGGGACTGGTCTCATCCGCCGGTGCCACCTTGTATCCCGAGGCACAGCAGGATAGCCACAAGGAGGAGGAG
GCTCCCAAGAAGCCCAAGAAAATCAAGGCAAAGAAGGAGCTCGAGGCCAGCAAGTCCAAGTGGCAGGAATTCAAC
GCCAAATCCAAGATTTCCAAAACGAAGAAGAAGGAGAGCATGTTTCGCACTCCCGAGGGCATCAACGGCAGAGGT
GAGGATCGTCACGGCCCATTGACGTGCGAAATCACTGACACCCTTTCCAGTCGGCTTCACGGGGTCGGGACAGGC
CATGCGCAAGGATCCTGCTCGAGTTCGGCCCCACTACATGCCCGGTGACGACATCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail