Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10588
Gene name
LocationContig_870:7128..10413
Strand+
Gene length (bp)3285
Transcript length (bp)3285
Coding sequence length (bp)3285
Protein length (aa) 1095

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 412 434 22
2 449 471 22
3 478 497 19
4 512 534 22
5 565 587 22
6 597 616 19
7 677 699 22
8 709 731 22
9 761 783 22
10 793 815 22
11 851 873 22
12 883 905 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10588
MEDEPAASTTQDDEFFEIECGQSRHENENSPPAATSNNPSGRSHSLGSILDYKRTTQWLRDVLNHREAYTTKLTE
RPEKKKQEGQASLDGRRNSDPPQSDILSARRLSGTSVQTSRRKAKFDGYGFKTAVSDLERLLSEALSIASQVVDR
PGTPPRKGYKPPSVSLHSHCRSISSANCNSDSSRLNLTSSLSQDVADDGEEVELDEVARSKRPTCRHAATYSGLP
RRPRLNEIIQSYSSEGVEVGTREFPGEAEHANPAPHTGPQVSFEIPGRESTDMAAYPLATTSRVEAAAGSGSSEG
LQSHPGHADAPRRHAKEIVVQLKPEQASGAARWHVGKRAARKPHESHGAARRGNEALPERDIAGRPMHGEHGISL
RRRSHVSLRGAAGFNLAKSRKRQPTARDWSPIRKRFVAAVACISTALVGVILGIYAGLVPSIQYYIIDQSYATVH
GNTGCFLGLAVPTFFLWPLPLLHGRKPYILSSLVLAMPLLFPQALAVNSQRLTHTGSWRSMLLVSRTLMGGCLGF
ASMNFHSMLTDLFGASLMSVNPHQEVVDQYDARRHGGGMGAWLGIWTWCWIGSLGLGFLIGACIIDGHQPTWGFY
VSIVIIAAVLFLNVVCPEVRRSAFRRSIAEVRTGSDISRRIARGEIMMHRVKTGPKWWGQEAYHGVALSLEMLRQ
PGFAVLALYSAWIYAQVVLVIVLLGSLASRLYKLRSPAVGLLVGSMALGACLAIPFEKANVFSRSRQAQMNSNLA
TLNRKVAWSSHLVRRTVFTLLLPLAGICYAAVSSGPPLHVSVPTVFAAAIGFLSCLAIAECNGLVMETFDCSDLS
PGMVGRQRSRSGKSQKLTNYSSFPRVTAGFAAIHGLAFVLAAGATALGGLVTRTLGQQVSTGVVASILFILTVTL
LVVLIRFSDVQIIPKCKSEVMDKLVEARRRSSTRRASTPDDPQAIMEEERAWRPVMIGNPTGKKRRMNVLELGSL
TRWQEIRKKNKLIDEGAHLNRAALDQGLEALDDQVSDLQREAREFFTRSGTRHKGSRHQRCTEDESGTADESVEM
EEMEAAGEERVPHERWRFRERECVMSQTVGEESEGEGREARRGR*
Coding >Hirsu2|10588
ATGGAGGACGAGCCCGCTGCTTCTACTACTCAGGACGACGAGTTCTTTGAGATCGAGTGTGGACAATCTCGACAT
GAAAATGAAAATTCGCCGCCGGCGGCCACGTCAAATAACCCGTCCGGCCGAAGTCATTCTCTGGGATCCATCTTG
GATTACAAGCGCACCACCCAGTGGCTCCGAGATGTCTTGAATCACCGCGAGGCCTATACAACAAAGCTCACGGAG
CGACCTGAGAAGAAGAAGCAAGAAGGGCAAGCGTCACTCGACGGAAGACGGAATTCCGACCCACCGCAGTCCGAC
ATTCTGTCCGCGCGCCGTCTGTCCGGGACCTCGGTACAGACTTCGAGGAGGAAGGCCAAGTTTGATGGGTATGGC
TTCAAAACCGCCGTGAGCGACCTGGAGAGGCTCTTGAGTGAAGCCCTGTCCATTGCATCCCAGGTTGTCGACCGC
CCTGGAACCCCTCCGCGCAAGGGATATAAGCCGCCGTCTGTCAGCCTCCATTCGCACTGCCGGAGCATTTCGAGC
GCCAACTGCAATTCCGACAGCTCCCGACTCAACCTCACGTCTTCTCTCAGTCAAGACGTTGCCGACGACGGGGAA
GAAGTCGAGCTGGACGAAGTGGCCCGGTCCAAAAGGCCGACGTGTAGACATGCGGCGACGTACTCTGGCCTTCCG
AGGAGGCCGCGGCTGAACGAGATCATCCAGAGCTACTCCAGCGAAGGCGTCGAGGTTGGGACGAGGGAATTCCCT
GGCGAGGCCGAGCACGCAAATCCGGCTCCCCATACGGGCCCGCAAGTCTCTTTCGAGATCCCCGGCCGCGAGTCC
ACCGACATGGCTGCGTATCCGCTCGCGACAACCAGCCGGGTCGAGGCCGCGGCCGGAAGCGGGAGCAGTGAGGGC
TTGCAGTCGCATCCGGGACATGCCGATGCGCCCAGAAGGCACGCAAAAGAGATCGTGGTCCAGCTCAAGCCCGAG
CAGGCGTCGGGCGCTGCGAGATGGCACGTCGGCAAGCGTGCGGCTCGGAAACCTCACGAATCCCACGGAGCTGCG
CGAAGAGGCAACGAAGCTCTTCCCGAGCGCGATATTGCCGGCCGGCCCATGCACGGCGAGCACGGCATCAGCCTC
CGGCGGCGGTCTCACGTGAGTCTGCGAGGCGCGGCGGGATTCAACCTTGCCAAGTCGCGAAAGCGGCAGCCGACG
GCCAGAGACTGGTCGCCGATACGCAAGAGGTTTGTCGCGGCCGTGGCCTGCATCAGCACTGCCCTCGTCGGAGTC
ATACTGGGCATCTACGCCGGCTTGGTGCCCTCGATCCAGTACTACATCATCGACCAGTCTTACGCCACCGTCCAC
GGAAACACGGGCTGCTTCCTCGGCCTGGCCGTGCCGACCTTCTTCCTCTGGCCGCTGCCGCTGCTTCACGGGCGG
AAGCCGTACATTCTGTCGAGCCTCGTCCTGGCCATGCCCCTGCTCTTCCCCCAGGCTCTTGCCGTCAATTCGCAG
AGGCTCACCCACACGGGGTCGTGGCGCAGCATGCTCCTCGTCTCTCGGACGCTCATGGGCGGCTGCCTCGGGTTC
GCAAGCATGAACTTCCACTCGATGCTGACCGACCTCTTTGGGGCGTCGCTGATGAGCGTGAATCCTCACCAAGAA
GTCGTCGACCAGTACGACGCCCGGCGGCATGGCGGCGGCATGGGCGCCTGGCTCGGCATCTGGACGTGGTGTTGG
ATCGGGTCCCTCGGGCTCGGCTTTCTCATCGGCGCCTGCATCATCGACGGCCACCAGCCGACATGGGGCTTCTAC
GTCAGCATCGTCATCATTGCCGCCGTCCTCTTCCTCAACGTCGTCTGCCCGGAAGTTCGCCGGTCCGCCTTTCGG
CGGTCGATCGCCGAGGTGAGGACGGGAAGCGACATTTCGCGACGAATCGCCCGGGGCGAGATCATGATGCACCGC
GTCAAGACCGGCCCCAAGTGGTGGGGACAGGAGGCTTACCACGGCGTTGCCCTGTCCCTGGAGATGCTCCGGCAG
CCCGGGTTCGCCGTCCTGGCGCTCTACTCGGCCTGGATCTACGCCCAGGTGGTGCTCGTCATCGTGCTGCTCGGG
TCCCTCGCGTCGCGGCTGTACAAGCTGCGGTCTCCGGCCGTCGGGCTGCTCGTCGGCTCCATGGCCCTGGGGGCG
TGCCTCGCGATTCCCTTCGAAAAGGCAAACGTCTTTTCGAGATCGCGCCAGGCGCAGATGAACAGCAACTTGGCG
ACGCTGAACCGCAAGGTGGCGTGGTCGTCTCATCTGGTCCGTCGGACCGTCTTCACGCTCCTCCTCCCCCTCGCC
GGCATCTGCTACGCCGCGGTCTCGTCGGGCCCTCCTCTGCACGTCAGCGTCCCGACCGTCTTCGCGGCGGCCATC
GGGTTCCTGTCATGCCTCGCGATCGCGGAGTGCAACGGCCTGGTGATGGAGACGTTCGACTGCTCGGACCTGTCG
CCCGGCATGGTGGGACGGCAGCGGAGCAGGTCGGGCAAGAGTCAGAAACTGACCAACTACTCTTCGTTCCCGCGC
GTCACGGCGGGCTTCGCCGCCATCCACGGGCTCGCCTTCGTCCTCGCGGCCGGGGCGACGGCGCTCGGGGGGCTC
GTGACGCGGACGCTCGGCCAGCAGGTATCGACGGGCGTGGTGGCGAGCATCCTCTTCATCCTCACGGTCACGCTG
CTCGTTGTCCTCATCCGGTTCAGCGACGTGCAGATCATACCCAAATGCAAGTCGGAGGTGATGGACAAGCTGGTC
GAGGCGCGGCGACGGTCGAGCACGCGTCGGGCGTCGACGCCCGACGACCCGCAGGCCATCATGGAGGAGGAGAGG
GCGTGGAGGCCCGTCATGATCGGCAACCCGACCGGGAAGAAGCGGCGGATGAACGTGCTCGAGCTCGGCAGCCTC
ACCCGGTGGCAGGAGATCCGCAAGAAGAACAAGCTGATCGACGAGGGCGCCCACCTGAACCGCGCGGCCCTGGAC
CAAGGGCTGGAGGCGCTGGACGACCAGGTGAGCGACCTGCAGAGAGAGGCACGCGAGTTCTTCACGAGGAGCGGC
ACGAGGCACAAGGGCTCGAGGCACCAACGGTGCACCGAGGACGAGAGCGGGACGGCCGACGAGTCGGTGGAGATG
GAGGAGATGGAGGCGGCGGGCGAAGAGAGGGTGCCGCACGAGAGGTGGCGCTTCCGGGAGAGGGAGTGCGTCATG
AGCCAGACGGTGGGAGAAGAAAGCGAGGGCGAGGGGCGAGAGGCGCGACGTGGGCGCTGA
Transcript >Hirsu2|10588
ATGGAGGACGAGCCCGCTGCTTCTACTACTCAGGACGACGAGTTCTTTGAGATCGAGTGTGGACAATCTCGACAT
GAAAATGAAAATTCGCCGCCGGCGGCCACGTCAAATAACCCGTCCGGCCGAAGTCATTCTCTGGGATCCATCTTG
GATTACAAGCGCACCACCCAGTGGCTCCGAGATGTCTTGAATCACCGCGAGGCCTATACAACAAAGCTCACGGAG
CGACCTGAGAAGAAGAAGCAAGAAGGGCAAGCGTCACTCGACGGAAGACGGAATTCCGACCCACCGCAGTCCGAC
ATTCTGTCCGCGCGCCGTCTGTCCGGGACCTCGGTACAGACTTCGAGGAGGAAGGCCAAGTTTGATGGGTATGGC
TTCAAAACCGCCGTGAGCGACCTGGAGAGGCTCTTGAGTGAAGCCCTGTCCATTGCATCCCAGGTTGTCGACCGC
CCTGGAACCCCTCCGCGCAAGGGATATAAGCCGCCGTCTGTCAGCCTCCATTCGCACTGCCGGAGCATTTCGAGC
GCCAACTGCAATTCCGACAGCTCCCGACTCAACCTCACGTCTTCTCTCAGTCAAGACGTTGCCGACGACGGGGAA
GAAGTCGAGCTGGACGAAGTGGCCCGGTCCAAAAGGCCGACGTGTAGACATGCGGCGACGTACTCTGGCCTTCCG
AGGAGGCCGCGGCTGAACGAGATCATCCAGAGCTACTCCAGCGAAGGCGTCGAGGTTGGGACGAGGGAATTCCCT
GGCGAGGCCGAGCACGCAAATCCGGCTCCCCATACGGGCCCGCAAGTCTCTTTCGAGATCCCCGGCCGCGAGTCC
ACCGACATGGCTGCGTATCCGCTCGCGACAACCAGCCGGGTCGAGGCCGCGGCCGGAAGCGGGAGCAGTGAGGGC
TTGCAGTCGCATCCGGGACATGCCGATGCGCCCAGAAGGCACGCAAAAGAGATCGTGGTCCAGCTCAAGCCCGAG
CAGGCGTCGGGCGCTGCGAGATGGCACGTCGGCAAGCGTGCGGCTCGGAAACCTCACGAATCCCACGGAGCTGCG
CGAAGAGGCAACGAAGCTCTTCCCGAGCGCGATATTGCCGGCCGGCCCATGCACGGCGAGCACGGCATCAGCCTC
CGGCGGCGGTCTCACGTGAGTCTGCGAGGCGCGGCGGGATTCAACCTTGCCAAGTCGCGAAAGCGGCAGCCGACG
GCCAGAGACTGGTCGCCGATACGCAAGAGGTTTGTCGCGGCCGTGGCCTGCATCAGCACTGCCCTCGTCGGAGTC
ATACTGGGCATCTACGCCGGCTTGGTGCCCTCGATCCAGTACTACATCATCGACCAGTCTTACGCCACCGTCCAC
GGAAACACGGGCTGCTTCCTCGGCCTGGCCGTGCCGACCTTCTTCCTCTGGCCGCTGCCGCTGCTTCACGGGCGG
AAGCCGTACATTCTGTCGAGCCTCGTCCTGGCCATGCCCCTGCTCTTCCCCCAGGCTCTTGCCGTCAATTCGCAG
AGGCTCACCCACACGGGGTCGTGGCGCAGCATGCTCCTCGTCTCTCGGACGCTCATGGGCGGCTGCCTCGGGTTC
GCAAGCATGAACTTCCACTCGATGCTGACCGACCTCTTTGGGGCGTCGCTGATGAGCGTGAATCCTCACCAAGAA
GTCGTCGACCAGTACGACGCCCGGCGGCATGGCGGCGGCATGGGCGCCTGGCTCGGCATCTGGACGTGGTGTTGG
ATCGGGTCCCTCGGGCTCGGCTTTCTCATCGGCGCCTGCATCATCGACGGCCACCAGCCGACATGGGGCTTCTAC
GTCAGCATCGTCATCATTGCCGCCGTCCTCTTCCTCAACGTCGTCTGCCCGGAAGTTCGCCGGTCCGCCTTTCGG
CGGTCGATCGCCGAGGTGAGGACGGGAAGCGACATTTCGCGACGAATCGCCCGGGGCGAGATCATGATGCACCGC
GTCAAGACCGGCCCCAAGTGGTGGGGACAGGAGGCTTACCACGGCGTTGCCCTGTCCCTGGAGATGCTCCGGCAG
CCCGGGTTCGCCGTCCTGGCGCTCTACTCGGCCTGGATCTACGCCCAGGTGGTGCTCGTCATCGTGCTGCTCGGG
TCCCTCGCGTCGCGGCTGTACAAGCTGCGGTCTCCGGCCGTCGGGCTGCTCGTCGGCTCCATGGCCCTGGGGGCG
TGCCTCGCGATTCCCTTCGAAAAGGCAAACGTCTTTTCGAGATCGCGCCAGGCGCAGATGAACAGCAACTTGGCG
ACGCTGAACCGCAAGGTGGCGTGGTCGTCTCATCTGGTCCGTCGGACCGTCTTCACGCTCCTCCTCCCCCTCGCC
GGCATCTGCTACGCCGCGGTCTCGTCGGGCCCTCCTCTGCACGTCAGCGTCCCGACCGTCTTCGCGGCGGCCATC
GGGTTCCTGTCATGCCTCGCGATCGCGGAGTGCAACGGCCTGGTGATGGAGACGTTCGACTGCTCGGACCTGTCG
CCCGGCATGGTGGGACGGCAGCGGAGCAGGTCGGGCAAGAGTCAGAAACTGACCAACTACTCTTCGTTCCCGCGC
GTCACGGCGGGCTTCGCCGCCATCCACGGGCTCGCCTTCGTCCTCGCGGCCGGGGCGACGGCGCTCGGGGGGCTC
GTGACGCGGACGCTCGGCCAGCAGGTATCGACGGGCGTGGTGGCGAGCATCCTCTTCATCCTCACGGTCACGCTG
CTCGTTGTCCTCATCCGGTTCAGCGACGTGCAGATCATACCCAAATGCAAGTCGGAGGTGATGGACAAGCTGGTC
GAGGCGCGGCGACGGTCGAGCACGCGTCGGGCGTCGACGCCCGACGACCCGCAGGCCATCATGGAGGAGGAGAGG
GCGTGGAGGCCCGTCATGATCGGCAACCCGACCGGGAAGAAGCGGCGGATGAACGTGCTCGAGCTCGGCAGCCTC
ACCCGGTGGCAGGAGATCCGCAAGAAGAACAAGCTGATCGACGAGGGCGCCCACCTGAACCGCGCGGCCCTGGAC
CAAGGGCTGGAGGCGCTGGACGACCAGGTGAGCGACCTGCAGAGAGAGGCACGCGAGTTCTTCACGAGGAGCGGC
ACGAGGCACAAGGGCTCGAGGCACCAACGGTGCACCGAGGACGAGAGCGGGACGGCCGACGAGTCGGTGGAGATG
GAGGAGATGGAGGCGGCGGGCGAAGAGAGGGTGCCGCACGAGAGGTGGCGCTTCCGGGAGAGGGAGTGCGTCATG
AGCCAGACGGTGGGAGAAGAAAGCGAGGGCGAGGGGCGAGAGGCGCGACGTGGGCGCTGA
Gene >Hirsu2|10588
ATGGAGGACGAGCCCGCTGCTTCTACTACTCAGGACGACGAGTTCTTTGAGATCGAGTGTGGACAATCTCGACAT
GAAAATGAAAATTCGCCGCCGGCGGCCACGTCAAATAACCCGTCCGGCCGAAGTCATTCTCTGGGATCCATCTTG
GATTACAAGCGCACCACCCAGTGGCTCCGAGATGTCTTGAATCACCGCGAGGCCTATACAACAAAGCTCACGGAG
CGACCTGAGAAGAAGAAGCAAGAAGGGCAAGCGTCACTCGACGGAAGACGGAATTCCGACCCACCGCAGTCCGAC
ATTCTGTCCGCGCGCCGTCTGTCCGGGACCTCGGTACAGACTTCGAGGAGGAAGGCCAAGTTTGATGGGTATGGC
TTCAAAACCGCCGTGAGCGACCTGGAGAGGCTCTTGAGTGAAGCCCTGTCCATTGCATCCCAGGTTGTCGACCGC
CCTGGAACCCCTCCGCGCAAGGGATATAAGCCGCCGTCTGTCAGCCTCCATTCGCACTGCCGGAGCATTTCGAGC
GCCAACTGCAATTCCGACAGCTCCCGACTCAACCTCACGTCTTCTCTCAGTCAAGACGTTGCCGACGACGGGGAA
GAAGTCGAGCTGGACGAAGTGGCCCGGTCCAAAAGGCCGACGTGTAGACATGCGGCGACGTACTCTGGCCTTCCG
AGGAGGCCGCGGCTGAACGAGATCATCCAGAGCTACTCCAGCGAAGGCGTCGAGGTTGGGACGAGGGAATTCCCT
GGCGAGGCCGAGCACGCAAATCCGGCTCCCCATACGGGCCCGCAAGTCTCTTTCGAGATCCCCGGCCGCGAGTCC
ACCGACATGGCTGCGTATCCGCTCGCGACAACCAGCCGGGTCGAGGCCGCGGCCGGAAGCGGGAGCAGTGAGGGC
TTGCAGTCGCATCCGGGACATGCCGATGCGCCCAGAAGGCACGCAAAAGAGATCGTGGTCCAGCTCAAGCCCGAG
CAGGCGTCGGGCGCTGCGAGATGGCACGTCGGCAAGCGTGCGGCTCGGAAACCTCACGAATCCCACGGAGCTGCG
CGAAGAGGCAACGAAGCTCTTCCCGAGCGCGATATTGCCGGCCGGCCCATGCACGGCGAGCACGGCATCAGCCTC
CGGCGGCGGTCTCACGTGAGTCTGCGAGGCGCGGCGGGATTCAACCTTGCCAAGTCGCGAAAGCGGCAGCCGACG
GCCAGAGACTGGTCGCCGATACGCAAGAGGTTTGTCGCGGCCGTGGCCTGCATCAGCACTGCCCTCGTCGGAGTC
ATACTGGGCATCTACGCCGGCTTGGTGCCCTCGATCCAGTACTACATCATCGACCAGTCTTACGCCACCGTCCAC
GGAAACACGGGCTGCTTCCTCGGCCTGGCCGTGCCGACCTTCTTCCTCTGGCCGCTGCCGCTGCTTCACGGGCGG
AAGCCGTACATTCTGTCGAGCCTCGTCCTGGCCATGCCCCTGCTCTTCCCCCAGGCTCTTGCCGTCAATTCGCAG
AGGCTCACCCACACGGGGTCGTGGCGCAGCATGCTCCTCGTCTCTCGGACGCTCATGGGCGGCTGCCTCGGGTTC
GCAAGCATGAACTTCCACTCGATGCTGACCGACCTCTTTGGGGCGTCGCTGATGAGCGTGAATCCTCACCAAGAA
GTCGTCGACCAGTACGACGCCCGGCGGCATGGCGGCGGCATGGGCGCCTGGCTCGGCATCTGGACGTGGTGTTGG
ATCGGGTCCCTCGGGCTCGGCTTTCTCATCGGCGCCTGCATCATCGACGGCCACCAGCCGACATGGGGCTTCTAC
GTCAGCATCGTCATCATTGCCGCCGTCCTCTTCCTCAACGTCGTCTGCCCGGAAGTTCGCCGGTCCGCCTTTCGG
CGGTCGATCGCCGAGGTGAGGACGGGAAGCGACATTTCGCGACGAATCGCCCGGGGCGAGATCATGATGCACCGC
GTCAAGACCGGCCCCAAGTGGTGGGGACAGGAGGCTTACCACGGCGTTGCCCTGTCCCTGGAGATGCTCCGGCAG
CCCGGGTTCGCCGTCCTGGCGCTCTACTCGGCCTGGATCTACGCCCAGGTGGTGCTCGTCATCGTGCTGCTCGGG
TCCCTCGCGTCGCGGCTGTACAAGCTGCGGTCTCCGGCCGTCGGGCTGCTCGTCGGCTCCATGGCCCTGGGGGCG
TGCCTCGCGATTCCCTTCGAAAAGGCAAACGTCTTTTCGAGATCGCGCCAGGCGCAGATGAACAGCAACTTGGCG
ACGCTGAACCGCAAGGTGGCGTGGTCGTCTCATCTGGTCCGTCGGACCGTCTTCACGCTCCTCCTCCCCCTCGCC
GGCATCTGCTACGCCGCGGTCTCGTCGGGCCCTCCTCTGCACGTCAGCGTCCCGACCGTCTTCGCGGCGGCCATC
GGGTTCCTGTCATGCCTCGCGATCGCGGAGTGCAACGGCCTGGTGATGGAGACGTTCGACTGCTCGGACCTGTCG
CCCGGCATGGTGGGACGGCAGCGGAGCAGGTCGGGCAAGAGTCAGAAACTGACCAACTACTCTTCGTTCCCGCGC
GTCACGGCGGGCTTCGCCGCCATCCACGGGCTCGCCTTCGTCCTCGCGGCCGGGGCGACGGCGCTCGGGGGGCTC
GTGACGCGGACGCTCGGCCAGCAGGTATCGACGGGCGTGGTGGCGAGCATCCTCTTCATCCTCACGGTCACGCTG
CTCGTTGTCCTCATCCGGTTCAGCGACGTGCAGATCATACCCAAATGCAAGTCGGAGGTGATGGACAAGCTGGTC
GAGGCGCGGCGACGGTCGAGCACGCGTCGGGCGTCGACGCCCGACGACCCGCAGGCCATCATGGAGGAGGAGAGG
GCGTGGAGGCCCGTCATGATCGGCAACCCGACCGGGAAGAAGCGGCGGATGAACGTGCTCGAGCTCGGCAGCCTC
ACCCGGTGGCAGGAGATCCGCAAGAAGAACAAGCTGATCGACGAGGGCGCCCACCTGAACCGCGCGGCCCTGGAC
CAAGGGCTGGAGGCGCTGGACGACCAGGTGAGCGACCTGCAGAGAGAGGCACGCGAGTTCTTCACGAGGAGCGGC
ACGAGGCACAAGGGCTCGAGGCACCAACGGTGCACCGAGGACGAGAGCGGGACGGCCGACGAGTCGGTGGAGATG
GAGGAGATGGAGGCGGCGGGCGAAGAGAGGGTGCCGCACGAGAGGTGGCGCTTCCGGGAGAGGGAGTGCGTCATG
AGCCAGACGGTGGGAGAAGAAAGCGAGGGCGAGGGGCGAGAGGCGCGACGTGGGCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail