Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10584
Gene name
LocationContig_87:36276..36909
Strand+
Gene length (bp)633
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00881 Nitroreductase Nitroreductase family 8.2E-16 18 185

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96VH4|HBN1_YEAST Putative nitroreductase HBN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBN1 PE=1 SV=1 14 208 7.0E-39
sp|P37261|FRM2_YEAST Fatty acid repression mutant protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRM2 PE=1 SV=2 14 198 6.0E-33

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10584
MSSAASKLSADVLLQMAKARRTIYNLNKTLPVPTSRVRELVQETTLHTPSSFNSQSTRVVVLTDSHHDKLWDIAT
EALRAIVPADKWEHSAKRMAMFRAAAGTVLFFSDDDAVHKMQADFPAYADRFPLWAAQSNGMQQYLLWTALELEG
CGANLQHYNPVIDQKVAEIWDLPASWKLNAQLVFGGRASAEPPAEKQFKPLEERVKFFGN*
Coding >Hirsu2|10584
ATGTCTTCCGCCGCCAGCAAGCTCTCGGCCGACGTGCTGCTGCAGATGGCCAAGGCGCGGCGGACCATCTACAAC
CTGAACAAGACGCTGCCGGTGCCGACGAGTCGGGTGCGGGAGCTTGTGCAGGAGACGACGCTGCACACGCCCTCG
TCCTTCAACTCGCAGTCGACCCGGGTGGTGGTGCTGACGGACTCGCACCACGACAAGCTGTGGGACATTGCGACG
GAGGCGCTGCGGGCGATTGTGCCCGCCGACAAGTGGGAGCACTCGGCCAAGCGCATGGCCATGTTCCGCGCCGCC
GCCGGCACCGTCCTCTTCTTCTCCGACGACGACGCCGTCCACAAGATGCAGGCCGACTTCCCCGCCTACGCCGAC
CGCTTCCCCCTCTGGGCCGCCCAGAGCAACGGGATGCAGCAGTATCTGCTCTGGACCGCCCTCGAGCTCGAGGGC
TGCGGCGCCAACCTGCAGCACTACAACCCCGTCATCGACCAGAAGGTCGCCGAGATCTGGGACCTTCCCGCCTCG
TGGAAGCTCAATGCCCAGCTCGTCTTCGGCGGCCGCGCCAGCGCCGAGCCTCCGGCCGAAAAGCAGTTCAAGCCC
CTCGAGGAGCGCGTCAAGTTCTTTGGCAACTAG
Transcript >Hirsu2|10584
ATGTCTTCCGCCGCCAGCAAGCTCTCGGCCGACGTGCTGCTGCAGATGGCCAAGGCGCGGCGGACCATCTACAAC
CTGAACAAGACGCTGCCGGTGCCGACGAGTCGGGTGCGGGAGCTTGTGCAGGAGACGACGCTGCACACGCCCTCG
TCCTTCAACTCGCAGTCGACCCGGGTGGTGGTGCTGACGGACTCGCACCACGACAAGCTGTGGGACATTGCGACG
GAGGCGCTGCGGGCGATTGTGCCCGCCGACAAGTGGGAGCACTCGGCCAAGCGCATGGCCATGTTCCGCGCCGCC
GCCGGCACCGTCCTCTTCTTCTCCGACGACGACGCCGTCCACAAGATGCAGGCCGACTTCCCCGCCTACGCCGAC
CGCTTCCCCCTCTGGGCCGCCCAGAGCAACGGGATGCAGCAGTATCTGCTCTGGACCGCCCTCGAGCTCGAGGGC
TGCGGCGCCAACCTGCAGCACTACAACCCCGTCATCGACCAGAAGGTCGCCGAGATCTGGGACCTTCCCGCCTCG
TGGAAGCTCAATGCCCAGCTCGTCTTCGGCGGCCGCGCCAGCGCCGAGCCTCCGGCCGAAAAGCAGTTCAAGCCC
CTCGAGGAGCGCGTCAAGTTCTTTGGCAACTAG
Gene >Hirsu2|10584
ATGTCTTCCGCCGCCAGCAAGCTCTCGGCCGACGTGCTGCTGCAGATGGCCAAGGCGCGGCGGACCATCTACAAC
CTGAACAAGACGCTGCCGGTGCCGACGAGTCGGGTGCGGGAGCTTGTGCAGGAGACGACGCTGCACACGCCCTCG
TCCTTCAACTCGCAGTCGACCCGGGTGGTGGTGCTGACGGACTCGCACCACGACAAGCTGTGGGACATTGCGACG
GAGGCGCTGCGGGCGATTGTGCCCGCCGACAAGTGGGAGCACTCGGCCAAGCGCATGGCCATGTTCCGCGCCGCC
GCCGGCACCGTCCTCTTCTTCTCCGACGACGACGCCGTCCACAAGATGCAGGCCGACTTCCCCGCCTACGCCGAC
CGCTTCCCCCTCTGGGCCGCCCAGAGCAACGGGATGCAGCAGTATCTGCTCTGGACCGCCCTCGAGCTCGAGGGC
TGCGGCGCCAACCTGCAGCACTACAACCCCGTCATCGACCAGAAGGTCGCCGAGATCTGGGACCTTCCCGCCTCG
TGGAAGCTCAATGCCCAGCTCGTCTTCGGCGGCCGCGCCAGCGCCGAGCCTCCGGCCGAAAAGCAGTTCAAGCCC
CTCGAGGAGCGCGTCAAGTTCTTTGGCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail