Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10583
Gene name
LocationContig_87:32639..34484
Strand+
Gene length (bp)1845
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00667 FAD_binding_1 FAD binding domain 1.2E-41 197 429
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.9E-09 475 578

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09744|YB63_SCHPO Uncharacterized FAD-binding protein C12C2.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.03c PE=3 SV=1 186 614 2.0E-132
sp|Q9US28|YKA1_SCHPO Uncharacterized FAD-binding protein C1783.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1783.01 PE=3 SV=1 108 614 7.0E-125
sp|Q17574|MTRR_CAEEL Putative methionine synthase reductase OS=Caenorhabditis elegans GN=tag-165 PE=3 SV=1 293 614 2.0E-34
sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus GN=MTRR PE=2 SV=1 179 614 1.0E-29
sp|Q3SYT8|NCPR_BOVIN NADPH--cytochrome P450 reductase OS=Bos taurus GN=POR PE=2 SV=3 165 614 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09744|YB63_SCHPO Uncharacterized FAD-binding protein C12C2.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.03c PE=3 SV=1 186 614 2.0E-132
sp|Q9US28|YKA1_SCHPO Uncharacterized FAD-binding protein C1783.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1783.01 PE=3 SV=1 108 614 7.0E-125
sp|Q17574|MTRR_CAEEL Putative methionine synthase reductase OS=Caenorhabditis elegans GN=tag-165 PE=3 SV=1 293 614 2.0E-34
sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus GN=MTRR PE=2 SV=1 179 614 1.0E-29
sp|Q3SYT8|NCPR_BOVIN NADPH--cytochrome P450 reductase OS=Bos taurus GN=POR PE=2 SV=3 165 614 3.0E-27
sp|Q8C1A3|MTRR_MOUSE Methionine synthase reductase OS=Mus musculus GN=Mtrr PE=1 SV=2 209 614 5.0E-27
sp|P00388|NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus GN=Por PE=1 SV=3 160 614 8.0E-27
sp|Q498R1|MTRR_RAT Methionine synthase reductase OS=Rattus norvegicus GN=Mtrr PE=2 SV=2 198 614 1.0E-26
sp|P37040|NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus GN=Por PE=1 SV=2 160 614 1.0E-25
sp|P37039|NCPR_CAVPO NADPH--cytochrome P450 reductase OS=Cavia porcellus GN=Por PE=2 SV=2 194 614 2.0E-25
sp|P00389|NCPR_RABIT NADPH--cytochrome P450 reductase OS=Oryctolagus cuniculus GN=POR PE=1 SV=1 194 614 3.0E-25
sp|Q9UBK8|MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens GN=MTRR PE=1 SV=3 172 614 7.0E-25
sp|P16435|NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens GN=POR PE=1 SV=2 160 614 2.0E-24
sp|P04175|NCPR_PIG NADPH--cytochrome P450 reductase OS=Sus scrofa GN=POR PE=1 SV=2 194 614 2.0E-24
sp|Q9SUM3|NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 197 614 2.0E-24
sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 203 609 6.0E-23
sp|Q27597|NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster GN=Cpr PE=2 SV=2 294 614 4.0E-22
sp|Q07994|NCPR_MUSDO NADPH--cytochrome P450 reductase OS=Musca domestica PE=2 SV=1 194 614 6.0E-22
sp|Q9SB48|NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana GN=ATR1 PE=1 SV=1 300 614 7.0E-22
sp|Q55CT1|NCPR_DICDI NADPH--cytochrome P450 reductase OS=Dictyostelium discoideum GN=redB PE=2 SV=1 199 614 8.0E-22
sp|P37116|NCPR_VIGRR NADPH--cytochrome P450 reductase OS=Vigna radiata var. radiata PE=1 SV=1 199 614 8.0E-22
sp|Q05001|NCPR_CATRO NADPH--cytochrome P450 reductase OS=Catharanthus roseus GN=CPR PE=2 SV=1 201 614 4.0E-21
sp|Q6NPS8|NDOR1_ARATH NADPH-dependent diflavin oxidoreductase 1 OS=Arabidopsis thaliana GN=ATR3 PE=1 SV=1 209 614 7.0E-21
sp|Q65T53|CYSJ_MANSM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysJ PE=3 SV=1 199 609 3.0E-20
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 201 614 3.0E-20
sp|Q9JS45|CYSJ_NEIMB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysJ1 PE=3 SV=1 283 609 2.0E-19
sp|A9LZ73|CYSJ_NEIM0 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysJ PE=3 SV=1 199 609 4.0E-19
sp|Q9JUD8|CYSJ_NEIMA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysJ PE=3 SV=1 199 609 4.0E-19
sp|A1KU06|CYSJ_NEIMF Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysJ PE=3 SV=1 199 609 8.0E-19
sp|Q8K9D3|CYSJ_BUCAP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysJ PE=3 SV=1 201 599 2.0E-18
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 196 614 2.0E-18
sp|Q54B10|REDA_DICDI NADPH oxidoreductase A OS=Dictyostelium discoideum GN=redA PE=2 SV=1 199 614 3.0E-18
sp|O61608|NOS_ANOST Nitric oxide synthase OS=Anopheles stephensi PE=2 SV=2 232 609 7.0E-18
sp|Q54JL0|NDOR1_DICDI NADPH-dependent diflavin oxidoreductase 1 OS=Dictyostelium discoideum GN=redC PE=2 SV=1 168 591 7.0E-18
sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1 OS=Danio rerio GN=ndor1 PE=2 SV=1 195 614 9.0E-18
sp|P19618|NCPR_SALTR NADPH--cytochrome P450 reductase (Fragments) OS=Salmo trutta GN=por PE=1 SV=1 152 614 1.0E-17
sp|P57503|CYSJ_BUCAI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysJ PE=3 SV=1 203 599 2.0E-17
sp|O94613|NDOR1_SCHPO NADPH-dependent diflavin oxidoreductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tah18 PE=3 SV=2 240 614 4.0E-17
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 239 605 6.0E-17
sp|A5F3I4|CYSJ_VIBC3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysJ PE=3 SV=1 199 609 7.0E-17
sp|Q32CG3|CYSJ_SHIDS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysJ PE=3 SV=1 201 599 8.0E-17
sp|Q9KUX4|CYSJ_VIBCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysJ PE=3 SV=1 199 609 9.0E-17
sp|Q8X7U1|CYSJ_ECO57 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O157:H7 GN=cysJ PE=3 SV=3 201 599 1.0E-16
sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 295 609 1.0E-16
sp|A8A3P5|CYSJ_ECOHS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O9:H4 (strain HS) GN=cysJ PE=3 SV=1 201 599 1.0E-16
sp|A2AI05|NDOR1_MOUSE NADPH-dependent diflavin oxidoreductase 1 OS=Mus musculus GN=Ndor1 PE=2 SV=1 131 614 2.0E-16
sp|Q8EAZ9|CYSJ_SHEON Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella oneidensis (strain MR-1) GN=cysJ PE=3 SV=1 188 609 2.0E-16
sp|Q0HFL6|CYSJ_SHESM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-4) GN=cysJ PE=3 SV=1 199 609 2.0E-16
sp|Q83QD9|CYSJ_SHIFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri GN=cysJ PE=3 SV=3 201 599 2.0E-16
sp|Q0T1I8|CYSJ_SHIF8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri serotype 5b (strain 8401) GN=cysJ PE=3 SV=1 201 599 2.0E-16
sp|Q3YY94|CYSJ_SHISS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella sonnei (strain Ss046) GN=cysJ PE=3 SV=1 201 599 2.0E-16
sp|Q8FEI7|CYSJ_ECOL6 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysJ PE=3 SV=3 201 599 3.0E-16
sp|P38038|CYSJ_ECOLI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain K12) GN=cysJ PE=1 SV=4 201 599 3.0E-16
sp|Q1R7T4|CYSJ_ECOUT Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain UTI89 / UPEC) GN=cysJ PE=3 SV=1 201 599 3.0E-16
sp|Q0TEA2|CYSJ_ECOL5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysJ PE=3 SV=1 201 599 3.0E-16
sp|A1AEV0|CYSJ_ECOK1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O1:K1 / APEC GN=cysJ PE=3 SV=1 201 599 3.0E-16
sp|Q7N8L6|CYSJ_PHOLL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysJ PE=3 SV=1 364 599 3.0E-16
sp|B1IU77|CYSJ_ECOLC Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysJ PE=3 SV=1 201 599 4.0E-16
sp|A7ZQK7|CYSJ_ECO24 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysJ PE=3 SV=1 201 599 4.0E-16
sp|A0KTH4|CYSJ_SHESA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain ANA-3) GN=cysJ PE=3 SV=1 199 609 4.0E-16
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 300 605 4.0E-16
sp|A9N2E6|CYSJ_SALPB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysJ PE=3 SV=1 201 599 5.0E-16
sp|Q66ED4|CYSJ_YERPS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysJ PE=3 SV=1 370 609 5.0E-16
sp|A4TPY5|CYSJ_YERPP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis (strain Pestoides F) GN=cysJ PE=3 SV=1 370 609 5.0E-16
sp|Q1CLS8|CYSJ_YERPN Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysJ PE=3 SV=1 370 609 5.0E-16
sp|A7FLZ0|CYSJ_YERP3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysJ PE=3 SV=1 370 609 5.0E-16
sp|Q8ZBN6|CYSJ_YERPE Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis GN=cysJ PE=3 SV=1 370 609 6.0E-16
sp|Q1C3Z0|CYSJ_YERPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysJ PE=3 SV=1 370 609 6.0E-16
sp|Q31XM4|CYSJ_SHIBS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella boydii serotype 4 (strain Sb227) GN=cysJ PE=3 SV=1 201 599 6.0E-16
sp|Q57KH7|CYSJ_SALCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella choleraesuis (strain SC-B67) GN=cysJ PE=3 SV=3 201 599 6.0E-16
sp|P38039|CYSJ_SALTY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysJ PE=3 SV=2 201 599 7.0E-16
sp|A9MF16|CYSJ_SALAR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysJ PE=3 SV=1 362 609 8.0E-16
sp|Q0HYB4|CYSJ_SHESR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-7) GN=cysJ PE=3 SV=1 199 609 8.0E-16
sp|A8ANX1|CYSJ_CITK8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysJ PE=3 SV=1 362 599 1.0E-15
sp|Q5NRM1|CYSJ_ZYMMO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysJ PE=3 SV=1 370 599 1.0E-15
sp|O19114|NOS2_RABIT Nitric oxide synthase, inducible (Fragment) OS=Oryctolagus cuniculus GN=NOS2 PE=2 SV=1 297 603 2.0E-15
sp|Q8Z458|CYSJ_SALTI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhi GN=cysJ PE=3 SV=3 201 599 3.0E-15
sp|P39692|MET10_YEAST Sulfite reductase [NADPH] flavoprotein component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET10 PE=1 SV=2 190 614 3.0E-15
sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1 OS=Homo sapiens GN=NDOR1 PE=1 SV=1 295 614 4.0E-15
sp|A1JJS2|CYSJ_YERE8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysJ PE=3 SV=1 370 599 4.0E-15
sp|A6TD49|CYSJ_KLEP7 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysJ PE=3 SV=1 201 599 5.0E-15
sp|Q5PEH7|CYSJ_SALPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysJ PE=3 SV=3 201 599 6.0E-15
sp|A4WDW1|CYSJ_ENT38 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Enterobacter sp. (strain 638) GN=cysJ PE=3 SV=1 362 599 7.0E-15
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 297 605 8.0E-15
sp|Q6D1A1|CYSJ_PECAS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysJ PE=3 SV=1 370 599 1.0E-14
sp|O62699|NOS2_CANLF Nitric oxide synthase, inducible OS=Canis lupus familiaris GN=NOS2 PE=2 SV=2 197 605 1.0E-14
sp|Q87L90|CYSJ_VIBPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysJ PE=3 SV=1 199 609 2.0E-14
sp|Q2NVN4|CYSJ_SODGM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Sodalis glossinidius (strain morsitans) GN=cysJ PE=3 SV=1 370 599 2.0E-14
sp|P29475|NOS1_HUMAN Nitric oxide synthase, brain OS=Homo sapiens GN=NOS1 PE=1 SV=2 310 609 2.0E-14
sp|Q9HDG2|NCPR_PHACH NADPH--cytochrome P450 reductase OS=Phanerochaete chrysosporium GN=CPR PE=2 SV=1 199 614 3.0E-14
sp|A7MJ63|CYSJ_CROS8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysJ PE=3 SV=1 362 599 4.0E-14
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 199 614 7.0E-14
sp|Q1LTP1|CYSJ_BAUCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysJ PE=3 SV=1 357 599 1.0E-13
sp|Q12181|NDOR1_YEAST NADPH-dependent diflavin oxidoreductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAH18 PE=1 SV=1 201 614 1.0E-13
sp|P29476|NOS1_RAT Nitric oxide synthase, brain OS=Rattus norvegicus GN=Nos1 PE=1 SV=1 310 609 1.0E-13
sp|Q9Z0J4|NOS1_MOUSE Nitric oxide synthase, brain OS=Mus musculus GN=Nos1 PE=1 SV=1 310 609 2.0E-13
sp|P16603|NCPR_YEAST NADPH--cytochrome P450 reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCP1 PE=1 SV=3 468 614 2.0E-13
sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens GN=NOS2 PE=1 SV=2 300 605 2.0E-13
sp|Q4P3D8|NDOR1_USTMA NADPH-dependent diflavin oxidoreductase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TAH18 PE=3 SV=2 297 614 2.0E-13
sp|O19132|NOS1_RABIT Nitric oxide synthase, brain OS=Oryctolagus cuniculus GN=NOS1 PE=2 SV=1 236 609 3.0E-13
sp|Q5BB41|NDOR1_EMENI NADPH-dependent diflavin oxidoreductase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tah18 PE=3 SV=3 286 614 3.0E-13
sp|A8G9X6|CYSJ_SERP5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Serratia proteamaculans (strain 568) GN=cysJ PE=3 SV=1 370 599 5.0E-13
sp|Q27995|NOS2_BOVIN Nitric oxide synthase, inducible OS=Bos taurus GN=NOS2 PE=2 SV=3 197 605 6.0E-13
sp|Q8DCK2|CYSJ_VIBVU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain CMCP6) GN=cysJ PE=3 SV=1 356 609 8.0E-13
sp|P0CP12|NDOR1_CRYNJ NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TAH18 PE=3 SV=1 294 614 9.0E-13
sp|P0CP13|NDOR1_CRYNB NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TAH18 PE=3 SV=1 294 614 9.0E-13
sp|Q6LM58|CYSJ_PHOPR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photobacterium profundum GN=cysJ PE=3 SV=1 365 609 1.0E-12
sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysJ PE=3 SV=1 370 609 1.0E-12
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 300 605 1.0E-12
sp|P70313|NOS3_MOUSE Nitric oxide synthase, endothelial OS=Mus musculus GN=Nos3 PE=1 SV=4 198 609 2.0E-12
sp|Q4WU59|NDOR1_ASPFU NADPH-dependent diflavin oxidoreductase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tah18 PE=3 SV=1 217 614 2.0E-12
sp|Q7MHA5|CYSJ_VIBVY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain YJ016) GN=cysJ PE=3 SV=2 356 609 2.0E-12
sp|Q6BR77|NDOR1_DEBHA NADPH-dependent diflavin oxidoreductase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TAH18 PE=3 SV=2 203 614 2.0E-12
sp|Q62600|NOS3_RAT Nitric oxide synthase, endothelial OS=Rattus norvegicus GN=Nos3 PE=1 SV=4 198 609 2.0E-12
sp|Q8T8C0|NOS_BOMMO Nitric oxide synthase OS=Bombyx mori GN=NOS PE=2 SV=1 234 599 2.0E-12
sp|Q7VQH2|CYSJ_BLOFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Blochmannia floridanus GN=cysJ PE=3 SV=1 364 601 7.0E-12
sp|A2QS05|NCPR_ASPNC NADPH--cytochrome P450 reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cprA PE=3 SV=1 310 614 1.0E-11
sp|Q6NRG5|NDOR1_XENLA NADPH-dependent diflavin oxidoreductase 1 OS=Xenopus laevis GN=ndor1 PE=2 SV=1 311 614 1.0E-11
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 198 601 2.0E-11
sp|Q5BFT5|NCPR_EMENI NADPH--cytochrome P450 reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cprA PE=3 SV=1 310 614 2.0E-11
sp|Q00141|NCPR_ASPNG NADPH--cytochrome P450 reductase OS=Aspergillus niger GN=cprA PE=1 SV=2 310 614 3.0E-11
sp|P36587|NCPR_SCHPO NADPH--cytochrome P450 reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr1 PE=2 SV=1 195 587 9.0E-11
sp|P52674|CYSJ_THIRO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Thiocapsa roseopersicina GN=cysJ PE=3 SV=1 469 592 1.0E-10
sp|Q1JPJ0|NDOR1_BOVIN NADPH-dependent diflavin oxidoreductase 1 OS=Bos taurus GN=NDOR1 PE=2 SV=2 297 614 1.0E-10
sp|P29473|NOS3_BOVIN Nitric oxide synthase, endothelial OS=Bos taurus GN=NOS3 PE=1 SV=3 198 609 2.0E-10
sp|Q4WM67|NCPR_ASPFU NADPH--cytochrome P450 reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cprA PE=1 SV=1 472 614 2.0E-10
sp|O32214|CYSJ_BACSU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Bacillus subtilis (strain 168) GN=cysJ PE=1 SV=1 472 599 3.0E-10
sp|Q0CMM0|NCPR_ASPTN NADPH--cytochrome P450 reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cprA PE=3 SV=1 310 614 5.0E-10
sp|Q2UHA7|NCPR_ASPOR NADPH--cytochrome P450 reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cprA PE=3 SV=1 472 614 1.0E-09
sp|Q6FRH1|NDOR1_CANGA NADPH-dependent diflavin oxidoreductase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TAH18 PE=3 SV=1 220 614 3.0E-09
sp|P50126|NCPR_CANMA NADPH--cytochrome P450 reductase OS=Candida maltosa GN=NCP1 PE=2 SV=1 148 614 6.0E-09
sp|Q6CVG8|NDOR1_KLULA NADPH-dependent diflavin oxidoreductase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TAH18 PE=3 SV=1 351 614 8.0E-09
sp|P37201|NCPR_CANTR NADPH--cytochrome P450 reductase OS=Candida tropicalis GN=NCP1 PE=3 SV=1 468 614 1.0E-08
sp|Q4HZQ1|NDOR1_GIBZE NADPH-dependent diflavin oxidoreductase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TAH18 PE=3 SV=2 266 583 3.0E-08
sp|Q5AD27|NDOR1_CANAL NADPH-dependent diflavin oxidoreductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TAH18 PE=3 SV=1 220 614 4.0E-08
sp|Q9TUX8|NOS3_CANLF Nitric oxide synthase, endothelial OS=Canis lupus familiaris GN=NOS3 PE=2 SV=1 201 609 6.0E-08
sp|Q09878|MET10_SCHPO Probable sulfite reductase [NADPH] flavoprotein component OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.01c PE=3 SV=2 198 614 2.0E-07
sp|Q9S9P8|FNRR2_ARATH Ferredoxin--NADP reductase, root isozyme 2, chloroplastic OS=Arabidopsis thaliana GN=RFNR2 PE=1 SV=1 474 589 4.0E-07
sp|P53991|FENR_CHLRE Ferredoxin--NADP reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PETH PE=1 SV=1 459 603 3.0E-06
sp|Q00598|FENR_CYAPA Ferredoxin--NADP reductase, cyanelle OS=Cyanophora paradoxa GN=PETH PE=1 SV=1 473 589 5.0E-06
sp|Q93RE3|FENR_THEEB Ferredoxin--NADP reductase OS=Thermosynechococcus elongatus (strain BP-1) GN=petH PE=3 SV=1 459 614 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10583
MADTLSRKVLASSSSSSTTSDCALSEPKTPSIAPSLTYSDDSDDQDELVRLDQTRPRRASTRLIAQNASDIRRIT
GETTAEFVGRCCGGGCCLMSSRRSGIECEQVPLPDNDAYRSLGLRITDIPTRLTKVAELPEKTASFSPIPSPRSL
PSPADSAISLASDRDPDLDKLALGRRVESVNTTLQPPRFVQPHPPFHVYPARIHATRELTKSGAEKRTYHFDLDV
TDYPDEESTDFKVGGAIGVTAPNCDTVVNDLFDALMVPRFLRDKPVLLTTTKGRWPTVWGDDRPRELVTTRRDLL
TWCADLQSYPPTKPLLRVLAEHASANDEKKILMYLCSAEGQGVFCDLRTGPHITVSQLLHAFPSSQPPLDELLSC
LQPLMPRFYSLSNDPHESCLIQDRKQHRLIEIAVTVHETDDWQHGTRTGVGSGFFERQARRFLKAQEAGVKNTEL
FIPMFKGLMANPLAKQFNADGPMLLIGAGVGIAPFRGFVQRRLKQANCANKVWVLQGIRDSLVDEIYSGEWGVHE
DEVKRVVQSRRGEGKYVQEEVRNQADLVWYIINAVDGRVFVCGSSKGMGEGVEEALVDVAMTKGNLEREEARNFW
QLKKEAGQYIAETW*
Coding >Hirsu2|10583
ATGGCGGACACTCTATCTCGCAAGGTCCTCGCCTCTTCCTCCTCCTCCTCCACCACCTCAGACTGCGCCCTCTCC
GAGCCTAAGACGCCATCCATCGCTCCCTCTCTCACCTACTCGGACGACTCGGACGACCAGGATGAGCTCGTCCGT
CTCGACCAGACGCGCCCCCGCCGTGCTTCGACCAGACTCATCGCCCAGAATGCCAGCGACATCCGGCGCATCACC
GGCGAGACCACCGCCGAGTTTGTCGGCCGCTGCTGCGGCGGCGGCTGCTGTCTGATGTCCTCGCGTCGGTCCGGT
ATCGAGTGCGAGCAGGTCCCCTTGCCCGACAACGACGCCTACCGCTCCCTCGGCCTGCGCATTACCGACATCCCC
ACCCGCCTGACCAAGGTCGCCGAACTGCCCGAAAAGACGGCATCGTTCAGCCCCATTCCTTCGCCCCGCAGCCTG
CCCTCGCCTGCCGATTCCGCCATTTCTCTCGCTTCCGACCGGGATCCCGACCTAGACAAGCTGGCTCTGGGCCGC
CGAGTCGAGTCCGTCAACACGACCCTGCAGCCGCCGCGATTTGTCCAGCCTCACCCGCCCTTCCACGTCTACCCG
GCTCGCATCCACGCCACCCGCGAGTTGACGAAGTCGGGCGCCGAGAAGCGCACCTATCACTTCGATCTCGATGTC
ACCGATTATCCCGACGAAGAATCTACCGACTTCAAGGTGGGCGGCGCCATCGGCGTCACCGCGCCCAACTGCGAC
ACCGTCGTCAACGATCTCTTCGATGCCCTCATGGTCCCGCGCTTCCTGCGCGACAAGCCCGTCCTTCTGACCACG
ACCAAGGGGCGCTGGCCCACCGTCTGGGGCGACGACAGGCCACGAGAGCTCGTCACAACCCGCCGAGACTTGCTC
ACCTGGTGTGCCGATCTCCAATCCTACCCGCCGACGAAGCCCCTCTTGCGCGTTCTCGCCGAACATGCCAGCGCG
AATGACGAGAAGAAGATCCTCATGTACCTCTGTTCCGCCGAAGGTCAGGGCGTCTTTTGCGACCTCCGCACCGGG
CCGCACATCACCGTCTCCCAGCTCCTGCACGCCTTCCCGAGCTCTCAGCCTCCCCTAGACGAGTTACTGTCCTGC
CTGCAGCCGCTCATGCCCCGCTTCTACTCCCTCTCGAATGACCCACACGAGTCGTGTCTGATCCAGGACCGGAAG
CAACACCGCCTTATCGAGATTGCCGTCACTGTGCACGAGACCGATGACTGGCAGCATGGGACCCGCACCGGCGTC
GGCTCTGGCTTCTTCGAACGCCAGGCTCGCCGCTTCCTTAAGGCGCAAGAGGCAGGGGTCAAGAACACCGAGCTG
TTCATTCCTATGTTCAAGGGGCTGATGGCGAATCCGCTGGCCAAGCAGTTCAACGCCGACGGCCCGATGCTCCTG
ATCGGTGCGGGGGTCGGCATCGCCCCCTTCCGAGGCTTTGTCCAGCGCCGGCTCAAGCAAGCCAACTGCGCCAAC
AAGGTCTGGGTCCTCCAGGGGATACGTGACTCCCTCGTCGACGAGATTTACAGCGGCGAATGGGGCGTCCACGAA
GACGAGGTCAAGCGGGTCGTGCAGAGCCGTCGCGGCGAGGGCAAGTACGTGCAGGAGGAGGTTCGCAACCAGGCT
GACCTCGTCTGGTACATCATCAACGCCGTCGACGGGCGAGTCTTTGTCTGCGGTAGCTCCAAGGGCATGGGAGAG
GGTGTCGAGGAGGCACTCGTGGACGTTGCCATGACCAAGGGCAACCTGGAGCGAGAGGAGGCGCGGAACTTCTGG
CAACTCAAGAAAGAAGCTGGACAGTACATCGCCGAGACTTGGTAA
Transcript >Hirsu2|10583
ATGGCGGACACTCTATCTCGCAAGGTCCTCGCCTCTTCCTCCTCCTCCTCCACCACCTCAGACTGCGCCCTCTCC
GAGCCTAAGACGCCATCCATCGCTCCCTCTCTCACCTACTCGGACGACTCGGACGACCAGGATGAGCTCGTCCGT
CTCGACCAGACGCGCCCCCGCCGTGCTTCGACCAGACTCATCGCCCAGAATGCCAGCGACATCCGGCGCATCACC
GGCGAGACCACCGCCGAGTTTGTCGGCCGCTGCTGCGGCGGCGGCTGCTGTCTGATGTCCTCGCGTCGGTCCGGT
ATCGAGTGCGAGCAGGTCCCCTTGCCCGACAACGACGCCTACCGCTCCCTCGGCCTGCGCATTACCGACATCCCC
ACCCGCCTGACCAAGGTCGCCGAACTGCCCGAAAAGACGGCATCGTTCAGCCCCATTCCTTCGCCCCGCAGCCTG
CCCTCGCCTGCCGATTCCGCCATTTCTCTCGCTTCCGACCGGGATCCCGACCTAGACAAGCTGGCTCTGGGCCGC
CGAGTCGAGTCCGTCAACACGACCCTGCAGCCGCCGCGATTTGTCCAGCCTCACCCGCCCTTCCACGTCTACCCG
GCTCGCATCCACGCCACCCGCGAGTTGACGAAGTCGGGCGCCGAGAAGCGCACCTATCACTTCGATCTCGATGTC
ACCGATTATCCCGACGAAGAATCTACCGACTTCAAGGTGGGCGGCGCCATCGGCGTCACCGCGCCCAACTGCGAC
ACCGTCGTCAACGATCTCTTCGATGCCCTCATGGTCCCGCGCTTCCTGCGCGACAAGCCCGTCCTTCTGACCACG
ACCAAGGGGCGCTGGCCCACCGTCTGGGGCGACGACAGGCCACGAGAGCTCGTCACAACCCGCCGAGACTTGCTC
ACCTGGTGTGCCGATCTCCAATCCTACCCGCCGACGAAGCCCCTCTTGCGCGTTCTCGCCGAACATGCCAGCGCG
AATGACGAGAAGAAGATCCTCATGTACCTCTGTTCCGCCGAAGGTCAGGGCGTCTTTTGCGACCTCCGCACCGGG
CCGCACATCACCGTCTCCCAGCTCCTGCACGCCTTCCCGAGCTCTCAGCCTCCCCTAGACGAGTTACTGTCCTGC
CTGCAGCCGCTCATGCCCCGCTTCTACTCCCTCTCGAATGACCCACACGAGTCGTGTCTGATCCAGGACCGGAAG
CAACACCGCCTTATCGAGATTGCCGTCACTGTGCACGAGACCGATGACTGGCAGCATGGGACCCGCACCGGCGTC
GGCTCTGGCTTCTTCGAACGCCAGGCTCGCCGCTTCCTTAAGGCGCAAGAGGCAGGGGTCAAGAACACCGAGCTG
TTCATTCCTATGTTCAAGGGGCTGATGGCGAATCCGCTGGCCAAGCAGTTCAACGCCGACGGCCCGATGCTCCTG
ATCGGTGCGGGGGTCGGCATCGCCCCCTTCCGAGGCTTTGTCCAGCGCCGGCTCAAGCAAGCCAACTGCGCCAAC
AAGGTCTGGGTCCTCCAGGGGATACGTGACTCCCTCGTCGACGAGATTTACAGCGGCGAATGGGGCGTCCACGAA
GACGAGGTCAAGCGGGTCGTGCAGAGCCGTCGCGGCGAGGGCAAGTACGTGCAGGAGGAGGTTCGCAACCAGGCT
GACCTCGTCTGGTACATCATCAACGCCGTCGACGGGCGAGTCTTTGTCTGCGGTAGCTCCAAGGGCATGGGAGAG
GGTGTCGAGGAGGCACTCGTGGACGTTGCCATGACCAAGGGCAACCTGGAGCGAGAGGAGGCGCGGAACTTCTGG
CAACTCAAGAAAGAAGCTGGACAGTACATCGCCGAGACTTGGTAA
Gene >Hirsu2|10583
ATGGCGGACACTCTATCTCGCAAGGTCCTCGCCTCTTCCTCCTCCTCCTCCACCACCTCAGACTGCGCCCTCTCC
GAGCCTAAGACGCCATCCATCGCTCCCTCTCTCACCTACTCGGACGACTCGGACGACCAGGATGAGCTCGTCCGT
CTCGACCAGACGCGCCCCCGCCGTGCTTCGACCAGACTCATCGCCCAGAATGCCAGCGACATCCGGCGCATCACC
GGCGAGACCACCGCCGAGTTTGTCGGCCGCTGCTGCGGCGGCGGCTGCTGTCTGATGTCCTCGCGTCGGTCCGGT
ATCGAGTGCGAGCAGGTCCCCTTGCCCGACAACGACGCCTACCGCTCCCTCGGCCTGCGCATTACCGACATCCCC
ACCCGCCTGACCAAGGTCGCCGAACTGCCCGAAAAGACGGCATCGTTCAGCCCCATTCCTTCGCCCCGCAGCCTG
CCCTCGCCTGCCGATTCCGCCATTTCTCTCGCTTCCGACCGGGATCCCGACCTAGACAAGCTGGCTCTGGGCCGC
CGAGTCGAGTCCGTCAACACGACCCTGCAGCCGCCGCGATTTGTCCAGCCTCACCCGCCCTTCCACGTCTACCCG
GCTCGCATCCACGCCACCCGCGAGTTGACGAAGTCGGGCGCCGAGAAGCGCACCTATCACTTCGATCTCGATGTC
ACCGATTATCCCGACGAAGAATCTACCGACTTCAAGGTGGGCGGCGCCATCGGCGTCACCGCGCCCAACTGCGAC
ACCGTCGTCAACGATCTCTTCGATGCCCTCATGGTCCCGCGCTTCCTGCGCGACAAGCCCGTCCTTCTGACCACG
ACCAAGGGGCGCTGGCCCACCGTCTGGGGCGACGACAGGCCACGAGAGCTCGTCACAACCCGCCGAGACTTGCTC
ACCTGGTGTGCCGATCTCCAATCCTACCCGCCGACGAAGCCCCTCTTGCGCGTTCTCGCCGAACATGCCAGCGCG
AATGACGAGAAGAAGATCCTCATGTACCTCTGTTCCGCCGAAGGTCAGGGCGTCTTTTGCGACCTCCGCACCGGG
CCGCACATCACCGTCTCCCAGCTCCTGCACGCCTTCCCGAGCTCTCAGCCTCCCCTAGACGAGTTACTGTCCTGC
CTGCAGCCGCTCATGCCCCGCTTCTACTCCCTCTCGAATGACCCACACGAGTCGTGTCTGATCCAGGACCGGAAG
CAACACCGCCTTATCGAGATTGCCGTCACTGTGCACGAGACCGATGACTGGCAGCATGGGACCCGCACCGGCGTC
GGCTCTGGCTTCTTCGAACGCCAGGCTCGCCGCTTCCTTAAGGCGCAAGAGGCAGGGGTCAAGAACACCGAGCTG
TTCATTCCTATGTTCAAGGGGCTGATGGCGAATCCGCTGGCCAAGCAGTTCAACGCCGACGGCCCGATGCTCCTG
ATCGGTGCGGGGGTCGGCATCGCCCCCTTCCGAGGCTTTGTCCAGCGCCGGCTCAAGCAAGCCAACTGCGCCAAC
AAGGTCTGGGTCCTCCAGGGGATACGTGACTCCCTCGTCGACGAGATTTACAGCGGCGAATGGGGCGTCCACGAA
GACGAGGTCAAGCGGGTCGTGCAGAGCCGTCGCGGCGAGGGCAAGTACGTGCAGGAGGAGGTTCGCAACCAGGCT
GACCTCGTCTGGTACATCATCAACGCCGTCGACGGGCGAGTCTTTGTCTGCGGTAGCTCCAAGGGCATGGGAGAG
GGTGTCGAGGAGGCACTCGTGGACGTTGCCATGACCAAGGGCAACCTGGAGCGAGAGGAGGCGCGGAACTTCTGG
CAACTCAAGAAAGAAGCTGGACAGTACATCGCCGAGACTTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail