Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1057
Gene name
LocationContig_122:1826..3576
Strand-
Gene length (bp)1750
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08164 TRAUB Apoptosis-antagonizing transcription factor, C-terminal 9.1E-28 421 504
PF13339 AATF-Che1 Apoptosis antagonizing transcription factor 1.1E-25 237 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I327|BFR2_GIBZE Protein BFR2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BFR2 PE=3 SV=1 1 535 4.0E-176
sp|Q7S6P8|BFR2_NEUCR Protein bfr2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bfr2 PE=3 SV=1 234 535 2.0E-90
sp|Q5AW04|BFR2_EMENI Protein bfr2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bfr2 PE=3 SV=1 240 535 1.0E-40
sp|Q4WMI1|BFR2_ASPFU Protein bfr2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bfr2 PE=3 SV=1 240 535 1.0E-39
sp|Q6C9G2|BFR2_YARLI Protein BFR2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BFR2 PE=3 SV=1 237 514 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I327|BFR2_GIBZE Protein BFR2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BFR2 PE=3 SV=1 1 535 4.0E-176
sp|Q7S6P8|BFR2_NEUCR Protein bfr2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bfr2 PE=3 SV=1 234 535 2.0E-90
sp|Q5AW04|BFR2_EMENI Protein bfr2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bfr2 PE=3 SV=1 240 535 1.0E-40
sp|Q4WMI1|BFR2_ASPFU Protein bfr2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bfr2 PE=3 SV=1 240 535 1.0E-39
sp|Q6C9G2|BFR2_YARLI Protein BFR2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BFR2 PE=3 SV=1 237 514 3.0E-34
sp|Q06631|BFR2_YEAST Protein BFR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BFR2 PE=1 SV=1 240 518 1.0E-28
sp|Q9US05|BFR2_SCHPO Protein bfr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr2 PE=1 SV=1 236 533 3.0E-27
sp|Q5ZIM6|AATF_CHICK Protein AATF OS=Gallus gallus GN=AATF PE=2 SV=1 43 509 3.0E-27
sp|Q75EZ2|BFR2_ASHGO Protein BFR2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BFR2 PE=3 SV=1 240 533 1.0E-26
sp|Q5ACL9|BFR2_CANAL Protein BFR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BFR2 PE=3 SV=2 240 512 5.0E-26
sp|Q6FSD4|BFR2_CANGA Protein BFR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BFR2 PE=3 SV=1 232 531 6.0E-25
sp|Q6BXX1|BFR2_DEBHA Protein BFR2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BFR2 PE=3 SV=2 240 512 1.0E-24
sp|Q7S6P8|BFR2_NEUCR Protein bfr2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bfr2 PE=3 SV=1 7 184 1.0E-23
sp|Q6CTS8|BFR2_KLULA Protein BFR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BFR2 PE=3 SV=1 240 533 2.0E-22
sp|Q4P5V5|BFR2_USTMA Protein BFR2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BFR2 PE=3 SV=1 236 533 8.0E-21
sp|Q55E65|Y0496_DICDI Putative uncharacterized protein DDB_G0270496 OS=Dictyostelium discoideum GN=DDB_G0270496 PE=3 SV=2 228 505 1.0E-20
sp|Q9NY61|AATF_HUMAN Protein AATF OS=Homo sapiens GN=AATF PE=1 SV=1 207 512 2.0E-18
sp|P0CL90|BFR2_CRYNJ Protein BFR2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BFR2 PE=3 SV=1 236 505 1.0E-17
sp|P0CL91|BFR2_CRYNB Protein BFR2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BFR2 PE=3 SV=1 236 505 1.0E-17
sp|Q9QYW0|AATF_RAT Protein AATF OS=Rattus norvegicus GN=Aatf PE=1 SV=1 236 511 4.0E-17
sp|Q9JKX4|AATF_MOUSE Protein AATF OS=Mus musculus GN=Aatf PE=1 SV=1 236 506 7.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0044464 cell part No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044424 intracellular part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1057
MAKPAGRASKFRDPDETVAKDYDPEGDAPPSDRGSDDGSSEEEDAGTEHYLSVGKSRLRQREGVSLGPDYRGSRI
SRSALQAAGDSEEEEEEEEGSGETGSDDESEGSSEYDDPETADLAADEAQANDSDIDSDNAFAESDVERFDGFTF
RGSSTAAKATEKPAKKKSAKPTKRATAADYMSSSDEEEDYGGADLSDDEESGAELHDSEDEGSSEEDEGEASDDA
EGIGEDDESEEEVEKGMAIQQQRNIYDGLLNLRIRLQKALVAANTFPTMEEDGSTAESEPYEAAEEAAIKLLNTI
SSLRDNFAASHQIGDKRKRELSTSMPNEAIWDCLQEQDMQTDEFRKDRLERWSRKVRSVNVMALKSLGQRNYSLV
DSLEKQLGDLEGRLVKRTRVPRSCAPVQAARKVLVDENVYDDGDFYQLLLKELVDQRMVETSAGTASAVPTVMLT
AGKESKMRKQVDRKASKGRKMRFTVHEKLQNLMAPEDRRTWEQGAIDRLFGTLFGRKMQLDEEESEEEAMEDAEA
EEEGLRLFRNNV*
Coding >Hirsu2|1057
ATGGCGAAGCCGGCGGGCCGCGCATCGAAATTCCGAGATCCTGATGAAACGGTCGCCAAAGATTACGATCCGGAA
GGCGATGCACCGCCAAGCGATCGAGGCAGCGACGATGGATCCAGCGAAGAGGAAGATGCCGGGACCGAACACTAC
CTCTCTGTCGGCAAAAGTAGATTAAGGCAAAGAGAGGGCGTGTCGCTCGGGCCGGATTACAGGGGGTCTCGCATT
AGTCGATCCGCCCTGCAGGCTGCGGGCGACTCTGAAGAGGAGGAGGAGGAGGAGGAGGGAAGCGGCGAGACAGGA
AGTGATGATGAGAGCGAAGGCAGCTCCGAGTATGACGACCCGGAGACAGCCGATCTGGCGGCCGATGAAGCCCAG
GCAAACGATTCGGACATCGATAGCGACAACGCCTTTGCCGAGTCGGACGTGGAGCGTTTCGACGGCTTCACTTTC
CGAGGCAGCTCTACTGCGGCAAAAGCAACAGAAAAGCCTGCGAAGAAGAAATCCGCGAAACCGACCAAACGGGCC
ACGGCGGCAGACTACATGTCCTCGTCTGACGAGGAAGAGGACTACGGCGGCGCAGACTTGAGCGACGACGAAGAG
AGTGGTGCCGAGCTACATGATTCGGAGGACGAGGGCAGCTCCGAGGAAGACGAGGGAGAAGCGAGCGACGACGCA
GAGGGCATCGGGGAAGACGACGAGTCAGAAGAAGAAGTCGAAAAGGGTATGGCGATCCAACAGCAGCGCAACATA
TACGATGGCCTCTTGAACCTTCGCATCCGGCTGCAAAAGGCGCTCGTGGCAGCCAATACGTTTCCTACGATGGAG
GAAGATGGATCCACGGCAGAATCGGAACCCTACGAGGCGGCCGAAGAGGCGGCCATCAAGCTTCTCAACACGATC
AGCAGCCTCAGAGACAACTTTGCAGCCTCTCATCAGATCGGCGACAAGCGGAAACGAGAGCTGTCGACCTCGATG
CCGAATGAGGCAATTTGGGACTGTCTTCAGGAACAGGACATGCAAACGGATGAATTTCGAAAAGACCGACTGGAG
AGGTGGTCGCGAAAAGTGCGAAGCGTCAACGTGATGGCTCTCAAGAGCCTGGGCCAAAGGAACTATTCACTGGTG
GACAGCTTGGAAAAGCAGCTCGGCGACCTGGAAGGCCGCCTGGTCAAACGGACGCGAGTGCCTCGATCGTGTGCG
CCCGTGCAAGCTGCCAGGAAGGTGTTGGTGGACGAGAATGTGTACGACGACGGCGATTTCTATCAACTGCTCCTG
AAGGAGCTCGTGGACCAGCGGATGGTGGAGACGTCGGCGGGGACGGCCAGCGCGGTGCCGACGGTGATGCTCACG
GCGGGCAAGGAGTCCAAGATGCGCAAGCAGGTGGATCGCAAGGCGAGCAAGGGCCGGAAAATGCGCTTCACGGTG
CACGAAAAGCTGCAGAACTTAATGGCTCCGGAAGACAGGCGGACGTGGGAGCAAGGGGCCATCGACCGCCTGTTC
GGGACGCTGTTTGGCCGCAAGATGCAATTGGACGAGGAGGAGAGCGAGGAGGAGGCGATGGAGGATGCGGAGGCG
GAAGAGGAGGGGCTTCGTCTGTTCCGGAACAATGTCTAG
Transcript >Hirsu2|1057
ATGGCGAAGCCGGCGGGCCGCGCATCGAAATTCCGAGATCCTGATGAAACGGTCGCCAAAGATTACGATCCGGAA
GGCGATGCACCGCCAAGCGATCGAGGCAGCGACGATGGATCCAGCGAAGAGGAAGATGCCGGGACCGAACACTAC
CTCTCTGTCGGCAAAAGTAGATTAAGGCAAAGAGAGGGCGTGTCGCTCGGGCCGGATTACAGGGGGTCTCGCATT
AGTCGATCCGCCCTGCAGGCTGCGGGCGACTCTGAAGAGGAGGAGGAGGAGGAGGAGGGAAGCGGCGAGACAGGA
AGTGATGATGAGAGCGAAGGCAGCTCCGAGTATGACGACCCGGAGACAGCCGATCTGGCGGCCGATGAAGCCCAG
GCAAACGATTCGGACATCGATAGCGACAACGCCTTTGCCGAGTCGGACGTGGAGCGTTTCGACGGCTTCACTTTC
CGAGGCAGCTCTACTGCGGCAAAAGCAACAGAAAAGCCTGCGAAGAAGAAATCCGCGAAACCGACCAAACGGGCC
ACGGCGGCAGACTACATGTCCTCGTCTGACGAGGAAGAGGACTACGGCGGCGCAGACTTGAGCGACGACGAAGAG
AGTGGTGCCGAGCTACATGATTCGGAGGACGAGGGCAGCTCCGAGGAAGACGAGGGAGAAGCGAGCGACGACGCA
GAGGGCATCGGGGAAGACGACGAGTCAGAAGAAGAAGTCGAAAAGGGTATGGCGATCCAACAGCAGCGCAACATA
TACGATGGCCTCTTGAACCTTCGCATCCGGCTGCAAAAGGCGCTCGTGGCAGCCAATACGTTTCCTACGATGGAG
GAAGATGGATCCACGGCAGAATCGGAACCCTACGAGGCGGCCGAAGAGGCGGCCATCAAGCTTCTCAACACGATC
AGCAGCCTCAGAGACAACTTTGCAGCCTCTCATCAGATCGGCGACAAGCGGAAACGAGAGCTGTCGACCTCGATG
CCGAATGAGGCAATTTGGGACTGTCTTCAGGAACAGGACATGCAAACGGATGAATTTCGAAAAGACCGACTGGAG
AGGTGGTCGCGAAAAGTGCGAAGCGTCAACGTGATGGCTCTCAAGAGCCTGGGCCAAAGGAACTATTCACTGGTG
GACAGCTTGGAAAAGCAGCTCGGCGACCTGGAAGGCCGCCTGGTCAAACGGACGCGAGTGCCTCGATCGTGTGCG
CCCGTGCAAGCTGCCAGGAAGGTGTTGGTGGACGAGAATGTGTACGACGACGGCGATTTCTATCAACTGCTCCTG
AAGGAGCTCGTGGACCAGCGGATGGTGGAGACGTCGGCGGGGACGGCCAGCGCGGTGCCGACGGTGATGCTCACG
GCGGGCAAGGAGTCCAAGATGCGCAAGCAGGTGGATCGCAAGGCGAGCAAGGGCCGGAAAATGCGCTTCACGGTG
CACGAAAAGCTGCAGAACTTAATGGCTCCGGAAGACAGGCGGACGTGGGAGCAAGGGGCCATCGACCGCCTGTTC
GGGACGCTGTTTGGCCGCAAGATGCAATTGGACGAGGAGGAGAGCGAGGAGGAGGCGATGGAGGATGCGGAGGCG
GAAGAGGAGGGGCTTCGTCTGTTCCGGAACAATGTCTAG
Gene >Hirsu2|1057
ATGGCGAAGCCGGCGGGCCGCGCATCGAAATTCCGAGATCCTGATGAAACGGTCGCCAAAGGTAAATCTTCGCCC
GCAGACTGCTATTTGACGTTTGTCTCATTTTTGCCTAGATTACGATCCGGAAGGCGATGCACCGCCAAGCGATCG
AGGCAGCGACGATGGATCCAGCGAAGAGGAAGATGCCGGGACCGAACACTACCTCTCTGTCGGCAAAAGTAGATT
AAGGCAAAGAGAGGGCGTGTCGCTCGGGCCGGATTACAGGGGGTCTCGCATTAGTCGATCCGCCCTGCAGGCTGC
GGGCGACTCTGAAGAGGAGGAGGAGGAGGAGGAGGGAAGCGGCGAGACAGGAAGTGATGATGAGAGCGAAGGCAG
CTCCGAGTATGACGACCCGGAGACAGCCGATCTGGCGGCCGATGAAGCCCAGGCAAACGATTCGGACATCGATAG
CGACAACGCCTTTGCCGAGTCGGACGTGGAGCGTTTCGACGGCTTCACTTTCCGAGGCAGCTCTACTGCGGCAAA
AGCAACAGAAAAGCCTGCGAAGAAGAAATCCGCGAAACCGACCAAACGGGCCACGGCGGCAGACTACATGTCCTC
GTCTGACGAGGAAGAGGACTACGGCGGCGCAGACTTGAGCGACGACGAAGAGAGTGGTGCCGAGCTACATGATTC
GGAGGACGAGGGCAGCTCCGAGGAAGACGAGGGAGAAGCGAGCGACGACGCAGAGGGCATCGGGGAAGACGACGA
GTCAGAGTCAGAAGCAGGAACACATGATGGCAAGGGCGCTGGACCGGGATCGAAAGGAGCCCGCCCTAACGTAGC
CGCACTCTCGAATAGAGAAGAAGTCGAAAAGGGTATGGCGATCCAACAGCAGCGCAACATATACGATGGCCTCTT
GAACCTTCGCATCCGGCTGCAAAAGGCGCTCGTGGCAGCCAATACGTTTCCTACGATGGAGGAAGATGGATCCAC
GGCAGAATCGGAACCCTACGAGGCGGCCGAAGAGGCGGCCATCAAGCTTCTCAACACGATCAGCAGCCTCAGAGA
CAACTTTGCAGCCTCTCATCAGATCGGCGACAAGCGGAAACGAGAGCTGTCGACCTCGATGCCGAATGAGGCAAT
TTGGGACTGTCTTCAGGAACAGGACATGCAAACGGATGAATTTCGAAAAGACCGACTGGAGAGGTGGTCGCGAAA
AGTGCGAAGCGTCAACGTGATGGCTCTCAAGAGCCTGGGCCAAAGGAACTATTCACTGGTGGACAGCTTGGAAAA
GCAGCTCGGCGACCTGGAAGGCCGCCTGGTCAAACGGACGCGAGTGCCTCGATCGTGTGCGCCCGTGCAAGCTGC
CAGGAAGGTGTTGGTGGACGAGAATGTGTACGACGACGGCGATTTCTATCAACTGCTCCTGAAGGAGCTCGTGGA
CCAGCGGATGGTGGAGACGTCGGCGGGGACGGCCAGCGCGGTGCCGACGGTGATGCTCACGGCGGGCAAGGAGTC
CAAGATGCGCAAGCAGGTGGATCGCAAGGCGAGCAAGGGCCGGAAAATGCGCTTCACGGTGCACGAAAAGCTGCA
GAACTTAATGGCTCCGGAAGACAGGCGGACGTGGGAGCAAGGGGCCATCGACCGCCTGTTCGGGACGCTGTTTGG
CCGCAAGATGCAATTGGACGAGGAGGAGAGCGAGGAGGAGGCGATGGAGGATGCGGAGGCGGAAGAGGAGGGGCT
TCGTCTGTTCCGGAACAATGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail