Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10563
Gene name
LocationContig_866:5436..7164
Strand+
Gene length (bp)1728
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.9E-19 126 271
PF08031 BBE Berberine and berberine like 6.5E-05 513 550

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 28 557 9.0E-45
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 28 564 2.0E-40
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 115 551 2.0E-10
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 205 295 1.0E-09
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 205 295 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 28 557 9.0E-45
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 28 564 2.0E-40
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 115 551 2.0E-10
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 205 295 1.0E-09
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 205 295 1.0E-09
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 205 358 2.0E-09
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 205 295 2.0E-09
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 205 296 8.0E-09
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 145 428 3.0E-06
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 104 308 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10563
MPSVSCLLQIGLFANALAASRQPSDAIHSLNTTLGGRVRPIEPFSLPCYSKFNGRAVKRNEALCAERQAHYTDPA
YRREMPGAYMSDTSSIDASDAASTDQCLLDPHDPTNPDAWEGRDCRLGNLPSYYIQVESAADALEAFRHARMYGV
RLSIKTSGHSYVGDAGMKDSVLLWTRKLQHMKRHRRFVPSACPDTETFDAITTGAGVSCGEAYRYADEENVTIIC
GYSPTVGISGGWTQGGGHSVLSNVYGLGADRVVQFTVVTPDGRVRVANKCQNSDLFWALRGGGGGTYGLVMDSTH
IVEPSIRLSVASISVPGRQDVVGAFLDLMVDTAIELARDGWGGHIYGNKIVYVNPLITTLDSAKKSMGRVTELAN
AYGGSSDISISPNWYHFFEAHVLSSSYPVGNLNLVGCQLVPASLFENRGDRQKVKSHLRRMLAEGRMGYIPADSP
YLAGQSVEANETSVHPAWYSSLWQLCVAGRWEWNSTLDERVDVAQKLQRDSMRLRRLTGSGAAYKNEANPFTVDW
KTAWYGGKYEALLIAKKKYDPQRLLRCWGCVGWQEQDAEESTYTAFNQIY*
Coding >Hirsu2|10563
ATGCCATCGGTGTCTTGTCTTTTGCAAATTGGCCTGTTCGCCAACGCGTTGGCTGCAAGCAGGCAGCCGAGCGAC
GCCATCCACTCACTCAACACAACACTCGGCGGCCGAGTTCGGCCGATCGAGCCGTTTTCCCTGCCTTGCTACTCC
AAATTCAATGGCCGGGCCGTCAAGCGAAACGAGGCTCTCTGCGCCGAGCGCCAGGCCCATTACACGGACCCAGCA
TATCGCAGGGAGATGCCCGGTGCCTACATGTCCGACACGTCCTCCATCGACGCTTCGGACGCAGCTTCCACAGAC
CAGTGCCTTCTCGACCCCCATGACCCGACCAACCCGGACGCCTGGGAGGGCCGCGATTGCAGGCTTGGCAACCTG
CCCTCGTACTACATCCAAGTCGAGAGTGCCGCCGACGCGTTGGAGGCTTTCCGTCACGCTAGGATGTACGGGGTG
AGGCTGTCCATCAAGACCAGCGGCCACTCATACGTGGGAGACGCGGGCATGAAGGATTCCGTGCTTCTATGGACC
CGCAAACTGCAGCACATGAAGCGCCACCGCCGGTTCGTGCCATCCGCATGTCCGGATACCGAGACATTCGACGCC
ATCACGACCGGGGCAGGGGTAAGCTGCGGCGAGGCGTACCGGTACGCCGACGAGGAAAACGTGACCATCATCTGC
GGCTACTCTCCCACGGTTGGCATCTCGGGCGGCTGGACCCAGGGCGGCGGCCACTCGGTTCTCAGCAACGTCTAC
GGGCTCGGCGCTGATCGTGTCGTGCAGTTCACTGTCGTCACTCCGGACGGCCGGGTGCGCGTCGCAAACAAATGT
CAGAACTCGGATCTTTTCTGGGCCCTTCGTGGGGGCGGAGGAGGCACCTATGGTCTTGTGATGGATTCAACACAC
ATTGTCGAGCCCAGCATCCGTCTGTCGGTTGCATCCATCAGCGTTCCCGGTCGACAAGATGTTGTCGGTGCCTTT
TTGGATCTCATGGTCGATACTGCTATCGAGTTGGCTCGAGATGGATGGGGCGGTCACATATACGGCAATAAGATC
GTCTATGTCAATCCGCTTATCACGACGCTAGACAGCGCCAAGAAGTCGATGGGCAGAGTCACAGAACTTGCGAAT
GCTTACGGTGGAAGCTCAGATATCTCCATATCGCCCAACTGGTATCACTTCTTCGAAGCACACGTCTTAAGCTCG
AGCTATCCTGTCGGCAACCTCAACCTCGTTGGTTGCCAGCTCGTGCCCGCAAGTCTCTTCGAGAACCGGGGGGAC
CGGCAAAAGGTCAAAAGCCATCTTCGCAGAATGCTTGCGGAAGGCCGAATGGGGTACATCCCCGCCGACTCTCCG
TACCTGGCCGGCCAGAGCGTCGAAGCAAACGAGACTTCCGTCCACCCGGCGTGGTACAGCTCCTTGTGGCAGCTG
TGTGTCGCTGGGCGATGGGAGTGGAACAGTACGCTAGACGAGCGTGTCGACGTTGCCCAGAAGCTGCAGCGGGAC
TCGATGCGGCTGCGACGGTTGACGGGAAGCGGTGCCGCCTACAAGAACGAAGCGAACCCGTTCACGGTCGACTGG
AAGACGGCGTGGTACGGCGGAAAGTACGAGGCATTGCTGATCGCCAAGAAGAAGTACGATCCGCAGAGACTTCTG
AGGTGTTGGGGGTGTGTAGGCTGGCAGGAGCAGGATGCAGAAGAGTCGACTTATACAGCATTCAACCAGATTTAC
TAG
Transcript >Hirsu2|10563
ATGCCATCGGTGTCTTGTCTTTTGCAAATTGGCCTGTTCGCCAACGCGTTGGCTGCAAGCAGGCAGCCGAGCGAC
GCCATCCACTCACTCAACACAACACTCGGCGGCCGAGTTCGGCCGATCGAGCCGTTTTCCCTGCCTTGCTACTCC
AAATTCAATGGCCGGGCCGTCAAGCGAAACGAGGCTCTCTGCGCCGAGCGCCAGGCCCATTACACGGACCCAGCA
TATCGCAGGGAGATGCCCGGTGCCTACATGTCCGACACGTCCTCCATCGACGCTTCGGACGCAGCTTCCACAGAC
CAGTGCCTTCTCGACCCCCATGACCCGACCAACCCGGACGCCTGGGAGGGCCGCGATTGCAGGCTTGGCAACCTG
CCCTCGTACTACATCCAAGTCGAGAGTGCCGCCGACGCGTTGGAGGCTTTCCGTCACGCTAGGATGTACGGGGTG
AGGCTGTCCATCAAGACCAGCGGCCACTCATACGTGGGAGACGCGGGCATGAAGGATTCCGTGCTTCTATGGACC
CGCAAACTGCAGCACATGAAGCGCCACCGCCGGTTCGTGCCATCCGCATGTCCGGATACCGAGACATTCGACGCC
ATCACGACCGGGGCAGGGGTAAGCTGCGGCGAGGCGTACCGGTACGCCGACGAGGAAAACGTGACCATCATCTGC
GGCTACTCTCCCACGGTTGGCATCTCGGGCGGCTGGACCCAGGGCGGCGGCCACTCGGTTCTCAGCAACGTCTAC
GGGCTCGGCGCTGATCGTGTCGTGCAGTTCACTGTCGTCACTCCGGACGGCCGGGTGCGCGTCGCAAACAAATGT
CAGAACTCGGATCTTTTCTGGGCCCTTCGTGGGGGCGGAGGAGGCACCTATGGTCTTGTGATGGATTCAACACAC
ATTGTCGAGCCCAGCATCCGTCTGTCGGTTGCATCCATCAGCGTTCCCGGTCGACAAGATGTTGTCGGTGCCTTT
TTGGATCTCATGGTCGATACTGCTATCGAGTTGGCTCGAGATGGATGGGGCGGTCACATATACGGCAATAAGATC
GTCTATGTCAATCCGCTTATCACGACGCTAGACAGCGCCAAGAAGTCGATGGGCAGAGTCACAGAACTTGCGAAT
GCTTACGGTGGAAGCTCAGATATCTCCATATCGCCCAACTGGTATCACTTCTTCGAAGCACACGTCTTAAGCTCG
AGCTATCCTGTCGGCAACCTCAACCTCGTTGGTTGCCAGCTCGTGCCCGCAAGTCTCTTCGAGAACCGGGGGGAC
CGGCAAAAGGTCAAAAGCCATCTTCGCAGAATGCTTGCGGAAGGCCGAATGGGGTACATCCCCGCCGACTCTCCG
TACCTGGCCGGCCAGAGCGTCGAAGCAAACGAGACTTCCGTCCACCCGGCGTGGTACAGCTCCTTGTGGCAGCTG
TGTGTCGCTGGGCGATGGGAGTGGAACAGTACGCTAGACGAGCGTGTCGACGTTGCCCAGAAGCTGCAGCGGGAC
TCGATGCGGCTGCGACGGTTGACGGGAAGCGGTGCCGCCTACAAGAACGAAGCGAACCCGTTCACGGTCGACTGG
AAGACGGCGTGGTACGGCGGAAAGTACGAGGCATTGCTGATCGCCAAGAAGAAGTACGATCCGCAGAGACTTCTG
AGGTGTTGGGGGTGTGTAGGCTGGCAGGAGCAGGATGCAGAAGAGTCGACTTATACAGCATTCAACCAGATTTAC
TAG
Gene >Hirsu2|10563
ATGCCATCGGTGTCTTGTCTTTTGCAAATTGGCCTGTTCGCCAACGCGTTGGCTGCAAGCAGGCAGCCGAGCGAC
GCCATCCACTCACTCAACACAACACTCGGCGGCCGAGTTCGGCCGATCGAGCCGTTTTCCCTGCCTTGCTACTCC
AAATTCAATGGCCGGGCCGTCAAGCGAAACGAGGCTCTCTGCGCCGAGCGCCAGGCCCATTACACGGACCCAGCA
TATCGCAGGGAGATGCCCGGTGCCTACATGTCCGACACGTCCTCCATCGACGCTTCGGACGCAGCTTCCACAGAC
CAGTGCCTTCTCGACCCCCATGACCCGACCAACCCGGACGCCTGGGAGGGCCGCGATTGCAGGCTTGGCAACCTG
CCCTCGTACTACATCCAAGTCGAGAGTGCCGCCGACGCGTTGGAGGCTTTCCGTCACGCTAGGATGTACGGGGTG
AGGCTGTCCATCAAGACCAGCGGCCACTCATACGTGGGAGACGCGGGCATGAAGGATTCCGTGCTTCTATGGACC
CGCAAACTGCAGCACATGAAGCGCCACCGCCGGTTCGTGCCATCCGCATGTCCGGATACCGAGACATTCGACGCC
ATCACGACCGGGGCAGGGGTAAGCTGCGGCGAGGCGTACCGGTACGCCGACGAGGAAAACGTGACCATCATCTGC
GGCTACTCTCCCACGGTTGGCATCTCGGGCGGCTGGACCCAGGGCGGCGGCCACTCGGTTCTCAGCAACGTCTAC
GGGCTCGGCGCTGATCGTGTCGTGCAGTTCACTGTCGTCACTCCGGACGGCCGGGTGCGCGTCGCAAACAAATGT
CAGAACTCGGATCTTTTCTGGGCCCTTCGTGGGGGCGGAGGAGGCACCTATGGTCTTGTGATGGATTCAACACAC
ATTGTCGAGCCCAGCATCCGTCTGTCGGTTGCATCCATCAGCGTTCCCGGTCGACAAGATGTTGTCGGTGCCTTT
TTGGATCTCATGGTCGATACTGCTATCGAGTTGGCTCGAGATGGATGGGGCGGTCACATATACGGCAATAAGATC
GTCTATGTCAATCCGCTTATCACGACGCTAGACAGCGCCAAGAAGTCGATGGGCAGAGTCACAGAACTTGCGAAT
GCTTACGGTGGAAGCTCAGATATCTCCATATCGCCCAACTGGTATCACTTCTTCGAAGCACACGTCTTAAGCTCG
AGCTATCCTGTCGGCAACCTCAACCTCGTTGGTTGCCAGCTCGTGCCCGCAAGTCTCTTCGAGAACCGGGGGGAC
CGGCAAAAGGTCAAAAGCCATCTTCGCAGAATGCTTGCGGAAGGCCGAATGGGGTACATCCCCGCCGACTCTCCG
TACCTGGCCGGCCAGAGCGTCGAAGCAAACGAGACTTCCGTCCACCCGGCGTGGTACAGCTCCTTGTGGCAGCTG
TGTGTCGCTGGGCGATGGGAGTGGAACAGTACGCTAGACGAGCGTGTCGACGTTGCCCAGAAGCTGCAGCGGGAC
TCGATGCGGCTGCGACGGTTGACGGGAAGCGGTGCCGCCTACAAGAACGAAGCGAACCCGTTCACGGTCGACTGG
AAGACGGCGTGGTACGGCGGAAAGTACGAGGCATTGCTGATCGCCAAGAAGAAGTACGATCCGCAGAGACTTCTG
AGGTGTTGGGGGTGTGTAGGCTGGCAGGAGCAGGATGCAGAAGAGTCGACTTATACAGCATTCAACCAGATTTAC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail