Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10562
Gene name
LocationContig_866:4302..4929
Strand+
Gene length (bp)627
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1525 0.0807 0.9204 0.0883 0.0743 0.0131 0.1594 0.1501 0.1207 0.0027

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999761

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup152
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7750
Ophiocordyceps australis map64 (Brazil) OphauB2|3430
Ophiocordyceps australis map64 (Brazil) OphauB2|3673
Ophiocordyceps camponoti-floridani Ophcf2|05156
Ophiocordyceps camponoti-floridani Ophcf2|06146
Ophiocordyceps camponoti-rufipedis Ophun1|3120
Ophiocordyceps kimflemingae Ophio5|2075
Ophiocordyceps kimflemingae Ophio5|5571
Ophiocordyceps subramaniannii Hirsu2|10562 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2821
Ophiocordyceps subramaniannii Hirsu2|4940

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10562
MKITLTFTLLAISFLATAELQPRGNGYEEKFPTSEIVDLLCGGLRNMASDLAPPKTPGHPLRIMPFCLGVPQKPA
KENDPKTKTGVTRKPGHPLGPSKKMSPQQLVSRMLEREFSRLTQDFKLKLPGQTKGKTSSTSELFERIRENRPSK
ATKRLESLTSKWGANAILTLVNLCGYIQDVDAIFRSEATISRKTAVLKSIMPFLGCVR*
Coding >Hirsu2|10562
ATGAAAATCACACTCACTTTCACCCTCCTGGCAATTTCCTTCCTCGCTACTGCCGAGCTCCAACCGCGAGGAAAC
GGTTACGAGGAGAAATTCCCGACCTCTGAGATTGTCGACCTACTATGCGGAGGCCTAAGGAATATGGCGAGCGAC
CTGGCGCCGCCCAAGACCCCGGGGCACCCTTTGAGAATAATGCCCTTCTGTCTCGGCGTGCCTCAGAAGCCGGCC
AAAGAAAACGACCCGAAAACCAAAACCGGGGTTACGAGAAAGCCGGGACATCCCCTGGGGCCATCCAAGAAGATG
TCACCTCAGCAGCTGGTCAGCAGAATGTTGGAAAGAGAGTTCTCCAGACTAACACAGGATTTCAAACTCAAGCTG
CCCGGGCAGACCAAGGGTAAAACATCTTCCACAAGCGAGCTGTTCGAGAGAATCCGAGAGAATCGCCCGTCCAAG
GCAACTAAAAGGCTGGAGTCATTGACATCGAAATGGGGCGCCAACGCAATCTTGACGCTTGTCAACCTGTGCGGC
TATATCCAGGACGTGGATGCTATATTCAGGTCGGAAGCGACCATCTCACGGAAAACCGCGGTCCTGAAGTCCATC
ATGCCATTCTTGGGCTGTGTACGATGA
Transcript >Hirsu2|10562
ATGAAAATCACACTCACTTTCACCCTCCTGGCAATTTCCTTCCTCGCTACTGCCGAGCTCCAACCGCGAGGAAAC
GGTTACGAGGAGAAATTCCCGACCTCTGAGATTGTCGACCTACTATGCGGAGGCCTAAGGAATATGGCGAGCGAC
CTGGCGCCGCCCAAGACCCCGGGGCACCCTTTGAGAATAATGCCCTTCTGTCTCGGCGTGCCTCAGAAGCCGGCC
AAAGAAAACGACCCGAAAACCAAAACCGGGGTTACGAGAAAGCCGGGACATCCCCTGGGGCCATCCAAGAAGATG
TCACCTCAGCAGCTGGTCAGCAGAATGTTGGAAAGAGAGTTCTCCAGACTAACACAGGATTTCAAACTCAAGCTG
CCCGGGCAGACCAAGGGTAAAACATCTTCCACAAGCGAGCTGTTCGAGAGAATCCGAGAGAATCGCCCGTCCAAG
GCAACTAAAAGGCTGGAGTCATTGACATCGAAATGGGGCGCCAACGCAATCTTGACGCTTGTCAACCTGTGCGGC
TATATCCAGGACGTGGATGCTATATTCAGGTCGGAAGCGACCATCTCACGGAAAACCGCGGTCCTGAAGTCCATC
ATGCCATTCTTGGGCTGTGTACGATGA
Gene >Hirsu2|10562
ATGAAAATCACACTCACTTTCACCCTCCTGGCAATTTCCTTCCTCGCTACTGCCGAGCTCCAACCGCGAGGAAAC
GGTTACGAGGAGAAATTCCCGACCTCTGAGATTGTCGACCTACTATGCGGAGGCCTAAGGAATATGGCGAGCGAC
CTGGCGCCGCCCAAGACCCCGGGGCACCCTTTGAGAATAATGCCCTTCTGTCTCGGCGTGCCTCAGAAGCCGGCC
AAAGAAAACGACCCGAAAACCAAAACCGGGGTTACGAGAAAGCCGGGACATCCCCTGGGGCCATCCAAGAAGATG
TCACCTCAGCAGCTGGTCAGCAGAATGTTGGAAAGAGAGTTCTCCAGACTAACACAGGATTTCAAACTCAAGCTG
CCCGGGCAGACCAAGGGTAAAACATCTTCCACAAGCGAGCTGTTCGAGAGAATCCGAGAGAATCGCCCGTCCAAG
GCAACTAAAAGGCTGGAGTCATTGACATCGAAATGGGGCGCCAACGCAATCTTGACGCTTGTCAACCTGTGCGGC
TATATCCAGGACGTGGATGCTATATTCAGGTCGGAAGCGACCATCTCACGGAAAACCGCGGTCCTGAAGTCCATC
ATGCCATTCTTGGGCTGTGTACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail