Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10540
Gene name
LocationContig_861:3..754
Strand+
Gene length (bp)751
Transcript length (bp)657
Coding sequence length (bp)657
Protein length (aa) 219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 5.7E-37 1 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 1 218 4.0E-60
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 1 218 2.0E-44
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 1 190 2.0E-42
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 1 188 9.0E-41
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 1 191 4.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 1 218 4.0E-60
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 1 218 2.0E-44
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 1 190 2.0E-42
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 1 188 9.0E-41
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 1 191 4.0E-38
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 1 191 5.0E-37
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 1 188 1.0E-36
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 1 189 9.0E-36
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 1 190 1.0E-35
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 1 190 3.0E-33
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 1 218 9.0E-33
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 1 189 6.0E-29
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 2 191 3.0E-28
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 1 202 5.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 75 97 22
3 112 134 22
4 155 177 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10540
MKIPPRTMFWAQVVATTLSCFVQIIVLNLALGSIDNVCDPQQRDRFTCPGGRVFFSASVIWGLIGPNRMFSPGRI
YSGLFLFFILGAATPVAIQYGARRWPRSGAQFLMAPLLFGGAAAIPPATPLNYFSWGLVGFIFQYWIKNRHAAWW
GRLNFLTSCGLDLGLALATLFIFFAFSMQGIEPPRWWGNDVVATTMDVQGTAVEARVAEGQRFGPDAW*
Coding >Hirsu2|10540
ATGAAGATCCCGCCGCGGACCATGTTCTGGGCCCAGGTCGTCGCCACCACGCTCTCCTGCTTCGTCCAGATCATC
GTCCTCAACCTGGCTCTCGGCAGCATCGACAACGTCTGCGACCCGCAGCAGCGCGACCGCTTCACCTGTCCCGGC
GGCCGCGTCTTCTTTTCCGCCTCCGTCATCTGGGGCCTCATAGGCCCGAACCGCATGTTCTCGCCCGGCCGCATC
TACTCGGGCCTCTTCCTCTTCTTCATCCTCGGCGCCGCGACGCCCGTGGCCATCCAGTACGGCGCCCGGCGGTGG
CCGCGCTCGGGCGCCCAGTTCCTGATGGCGCCGCTCCTCTTCGGCGGCGCCGCCGCCATCCCGCCCGCCACGCCG
CTCAACTACTTCTCCTGGGGCCTCGTCGGCTTCATCTTCCAGTACTGGATCAAGAACCGCCACGCCGCCTGGTGG
GGGCGCCTCAACTTCCTGACCTCGTGCGGGCTCGACCTCGGCCTCGCCCTCGCCACCCTCTTCATCTTCTTCGCC
TTCTCCATGCAAGGCATCGAGCCGCCGCGCTGGTGGGGGAATGACGTCGTCGCCACCACCATGGACGTCCAGGGC
ACCGCCGTCGAGGCCCGCGTCGCCGAGGGGCAGCGCTTCGGGCCCGACGCGTGGTAG
Transcript >Hirsu2|10540
ATGAAGATCCCGCCGCGGACCATGTTCTGGGCCCAGGTCGTCGCCACCACGCTCTCCTGCTTCGTCCAGATCATC
GTCCTCAACCTGGCTCTCGGCAGCATCGACAACGTCTGCGACCCGCAGCAGCGCGACCGCTTCACCTGTCCCGGC
GGCCGCGTCTTCTTTTCCGCCTCCGTCATCTGGGGCCTCATAGGCCCGAACCGCATGTTCTCGCCCGGCCGCATC
TACTCGGGCCTCTTCCTCTTCTTCATCCTCGGCGCCGCGACGCCCGTGGCCATCCAGTACGGCGCCCGGCGGTGG
CCGCGCTCGGGCGCCCAGTTCCTGATGGCGCCGCTCCTCTTCGGCGGCGCCGCCGCCATCCCGCCCGCCACGCCG
CTCAACTACTTCTCCTGGGGCCTCGTCGGCTTCATCTTCCAGTACTGGATCAAGAACCGCCACGCCGCCTGGTGG
GGGCGCCTCAACTTCCTGACCTCGTGCGGGCTCGACCTCGGCCTCGCCCTCGCCACCCTCTTCATCTTCTTCGCC
TTCTCCATGCAAGGCATCGAGCCGCCGCGCTGGTGGGGGAATGACGTCGTCGCCACCACCATGGACGTCCAGGGC
ACCGCCGTCGAGGCCCGCGTCGCCGAGGGGCAGCGCTTCGGGCCCGACGCGTGGTAG
Gene >Hirsu2|10540
ATGAAGATCCCGCCGCGGACCATGTTCTGGGCCCAGGTCGTCGCCACCACGCTCTCCTGCTTCGTCCAGATCATC
GTCCTCAACCTGGCTCTCGGCAGCATCGACAACGTCTGCGACCCGCAGCAGCGCGACCGCTTCACCTGTCCCGGC
GGCCGCGTCTTCTTTTCCGGTGAGCCCTCCTTTCATCCTGTCCTTGTCGGCAGTTTCGCCGCACTGGAAAAAAGT
CCCCCTCGGTGCTGACGTCGCCTCCCTCCCCCCCTAAGCCTCCGTCATCTGGGGCCTCATAGGCCCGAACCGCAT
GTTCTCGCCCGGCCGCATCTACTCGGGCCTCTTCCTCTTCTTCATCCTCGGCGCCGCGACGCCCGTGGCCATCCA
GTACGGCGCCCGGCGGTGGCCGCGCTCGGGCGCCCAGTTCCTGATGGCGCCGCTCCTCTTCGGCGGCGCCGCCGC
CATCCCGCCCGCCACGCCGCTCAACTACTTCTCCTGGGGCCTCGTCGGCTTCATCTTCCAGTACTGGATCAAGAA
CCGCCACGCCGCCTGGTGGGGGCGCCTCAACTTCCTGACCTCGTGCGGGCTCGACCTCGGCCTCGCCCTCGCCAC
CCTCTTCATCTTCTTCGCCTTCTCCATGCAAGGCATCGAGCCGCCGCGCTGGTGGGGGAATGACGTCGTCGCCAC
CACCATGGACGTCCAGGGCACCGCCGTCGAGGCCCGCGTCGCCGAGGGGCAGCGCTTCGGGCCCGACGCGTGGTA
G

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail