Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10534
Gene name
LocationContig_86:39735..41638
Strand-
Gene length (bp)1903
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.3E-17 39 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 7 416 5.0E-54
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 32 407 3.0E-51
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 32 407 3.0E-51
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 32 407 2.0E-49
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 23 409 6.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 7 416 5.0E-54
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 32 407 3.0E-51
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 32 407 3.0E-51
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 32 407 2.0E-49
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 23 409 6.0E-37
sp|Q9ZK41|GLUP_HELPJ Putative glucose/galactose transporter OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gluP PE=3 SV=1 34 394 2.0E-34
sp|O25788|GLUP_HELPY Putative glucose/galactose transporter OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gluP PE=3 SV=1 34 394 1.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 31 50 19
2 70 92 22
3 99 118 19
4 123 145 22
5 166 185 19
6 195 217 22
7 248 270 22
8 285 307 22
9 314 333 19
10 337 359 22
11 371 390 19
12 400 422 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10534
MGLREFLARRSLKADDARRTPAAQLTLRDSIFPLGLVTVLFFLWGFSYGLLDTLNKHFQTVLHIDRARSSGLQAA
YFGAYPLASIGHAAWILRHFGYRAVFIWGLCLYALGALLAIPALKAESFGGFCACIFIIGNGLGSLETAANPFIT
VCGPPKYSEIRINISQAFNGIGTVIAPVLGSYVFFKFSDEHALDNVQWVYLSIAVFVLVLAAAFFFADIPEITDA
DMAFQAQETLASDDKPFRQQYRLFHAAFAQFCYTGAQVAIASFFINYASATRPGTDSALAAKLLAGAQAAFTLGR
FLGVGLMRLARPRLVFLVFLSCCIVFIGPTITQRGDVGVALLFVVLFFESICFPTIVALGMRGLGRHTKRGSGYI
VGGVVGGACVPPLAGLAGDRHGDGVAMVVPLVFFVAAWSYALCVNFVPAYTRVLDSVADADHRPREPQSPVDAFG
GPALASTEKVGQEERVSARAV*
Coding >Hirsu2|10534
ATGGGCCTCCGCGAGTTCCTCGCCCGGCGCTCCCTCAAGGCCGACGACGCCCGCCGCACGCCCGCCGCCCAGCTG
ACGCTGCGCGACTCCATCTTCCCCCTCGGCCTCGTCACCGTCCTCTTCTTCCTCTGGGGCTTCAGCTACGGCCTG
CTCGACACGCTCAACAAGCACTTCCAGACGGTGCTGCACATCGACCGCGCCCGCTCGTCCGGCCTGCAGGCCGCC
TACTTTGGGGCCTATCCGCTCGCCTCCATCGGCCATGCGGCCTGGATCCTCCGCCACTTCGGCTACCGCGCCGTC
TTCATCTGGGGCCTCTGCCTCTACGCCCTCGGCGCGCTGCTGGCCATCCCCGCCCTCAAGGCCGAGAGCTTCGGC
GGCTTCTGCGCCTGCATCTTCATCATCGGCAACGGCCTCGGCTCGCTCGAGACGGCCGCCAACCCTTTCATCACC
GTGTGCGGCCCGCCCAAGTACTCCGAGATCCGCATCAACATCTCGCAGGCCTTCAACGGCATAGGCACCGTCATC
GCCCCCGTCCTCGGCTCGTACGTCTTCTTCAAGTTCAGCGATGAGCACGCGCTCGACAACGTGCAGTGGGTCTAC
CTCTCCATCGCCGTCTTCGTCCTCGTCCTGGCCGCCGCCTTCTTCTTCGCCGACATTCCCGAGATCACCGATGCC
GACATGGCGTTCCAGGCGCAGGAGACGCTCGCGAGCGACGACAAGCCGTTCCGGCAGCAGTACCGGCTCTTCCAC
GCGGCCTTTGCGCAGTTCTGCTACACGGGCGCGCAGGTGGCCATCGCCAGCTTCTTCATCAACTACGCGAGCGCG
ACGCGGCCCGGGACGGACAGCGCGCTGGCGGCCAAGCTGCTGGCGGGCGCGCAGGCCGCCTTCACCCTCGGCCGC
TTCCTCGGCGTCGGCCTGATGCGGCTGGCCCGGCCGCGGCTCGTCTTCCTCGTCTTCCTCTCCTGCTGCATCGTC
TTCATCGGCCCGACCATCACGCAGCGCGGCGACGTCGGCGTCGCCCTCCTCTTCGTCGTCCTCTTCTTCGAGTCC
ATCTGCTTCCCGACCATTGTCGCGCTCGGCATGCGCGGCCTCGGCCGTCACACCAAGCGCGGCAGCGGCTACATC
GTCGGCGGCGTCGTCGGCGGCGCCTGCGTGCCTCCGCTGGCCGGCCTCGCCGGCGACCGCCACGGCGATGGCGTC
GCCATGGTCGTGCCTCTCGTCTTCTTCGTCGCCGCCTGGTCGTACGCCCTGTGCGTCAACTTCGTCCCGGCCTAC
ACCCGAGTCCTCGACTCCGTCGCCGACGCCGACCACCGGCCCCGCGAGCCCCAGTCTCCCGTCGACGCCTTCGGC
GGCCCGGCCTTGGCCTCCACCGAAAAGGTCGGCCAGGAGGAGCGCGTCTCGGCGCGGGCAGTATAA
Transcript >Hirsu2|10534
ATGGGCCTCCGCGAGTTCCTCGCCCGGCGCTCCCTCAAGGCCGACGACGCCCGCCGCACGCCCGCCGCCCAGCTG
ACGCTGCGCGACTCCATCTTCCCCCTCGGCCTCGTCACCGTCCTCTTCTTCCTCTGGGGCTTCAGCTACGGCCTG
CTCGACACGCTCAACAAGCACTTCCAGACGGTGCTGCACATCGACCGCGCCCGCTCGTCCGGCCTGCAGGCCGCC
TACTTTGGGGCCTATCCGCTCGCCTCCATCGGCCATGCGGCCTGGATCCTCCGCCACTTCGGCTACCGCGCCGTC
TTCATCTGGGGCCTCTGCCTCTACGCCCTCGGCGCGCTGCTGGCCATCCCCGCCCTCAAGGCCGAGAGCTTCGGC
GGCTTCTGCGCCTGCATCTTCATCATCGGCAACGGCCTCGGCTCGCTCGAGACGGCCGCCAACCCTTTCATCACC
GTGTGCGGCCCGCCCAAGTACTCCGAGATCCGCATCAACATCTCGCAGGCCTTCAACGGCATAGGCACCGTCATC
GCCCCCGTCCTCGGCTCGTACGTCTTCTTCAAGTTCAGCGATGAGCACGCGCTCGACAACGTGCAGTGGGTCTAC
CTCTCCATCGCCGTCTTCGTCCTCGTCCTGGCCGCCGCCTTCTTCTTCGCCGACATTCCCGAGATCACCGATGCC
GACATGGCGTTCCAGGCGCAGGAGACGCTCGCGAGCGACGACAAGCCGTTCCGGCAGCAGTACCGGCTCTTCCAC
GCGGCCTTTGCGCAGTTCTGCTACACGGGCGCGCAGGTGGCCATCGCCAGCTTCTTCATCAACTACGCGAGCGCG
ACGCGGCCCGGGACGGACAGCGCGCTGGCGGCCAAGCTGCTGGCGGGCGCGCAGGCCGCCTTCACCCTCGGCCGC
TTCCTCGGCGTCGGCCTGATGCGGCTGGCCCGGCCGCGGCTCGTCTTCCTCGTCTTCCTCTCCTGCTGCATCGTC
TTCATCGGCCCGACCATCACGCAGCGCGGCGACGTCGGCGTCGCCCTCCTCTTCGTCGTCCTCTTCTTCGAGTCC
ATCTGCTTCCCGACCATTGTCGCGCTCGGCATGCGCGGCCTCGGCCGTCACACCAAGCGCGGCAGCGGCTACATC
GTCGGCGGCGTCGTCGGCGGCGCCTGCGTGCCTCCGCTGGCCGGCCTCGCCGGCGACCGCCACGGCGATGGCGTC
GCCATGGTCGTGCCTCTCGTCTTCTTCGTCGCCGCCTGGTCGTACGCCCTGTGCGTCAACTTCGTCCCGGCCTAC
ACCCGAGTCCTCGACTCCGTCGCCGACGCCGACCACCGGCCCCGCGAGCCCCAGTCTCCCGTCGACGCCTTCGGC
GGCCCGGCCTTGGCCTCCACCGAAAAGGTCGGCCAGGAGGAGCGCGTCTCGGCGCGGGCAGTATAA
Gene >Hirsu2|10534
ATGGGCCTCCGCGAGTTCCTCGCCCGGCGCTCCCTCAAGGCCGACGACGCCCGCCGCACGCCCGCCGCCCAGCTG
ACGCTGCGCGACTCCATCTTCCCCCTCGGCCTCGTCACCGTCCTCTTCTTCCTCTGGGGCTTCAGCTACGGCCTG
CTCGACACGCTCAACAAGCACTTCCAGACGGTGCTGCACATCGACCGCGCCCGCTCGTCCGGCCTGCAGGCCGCC
TACTTTGGGTGCGCAACTCATTCTCTCCAGCCCCCTTTCTTTCCGTTCTCGCAAGGCTCCTCCTGCTTCTCACTG
CCTCCGTTCTCGTCTTCCTCGTCGTCGTTTGTCTCCTCGTCATCTCATGGCTCGCCTTCGTCCTCCTCCTCCGGT
CGCAACTCGTCCCTCGCAAGGCTTTGCTAACAGACTCTCTCTCTCTCTCTCTCTCTCCTCCAGGGCCTATCCGCT
CGCCTCCATCGGCCATGCGGCCTGGATCCTCCGCCACTTCGGCTACCGCGCCGTCTTCATCTGGGGCCTCTGCCT
CTACGCCCTCGGCGCGCTGCTGGCCATCCCCGCCCTCAAGGCCGAGAGCTTCGGCGGCTTCTGCGCCTGCATCTT
CATCATCGGCAACGGCCTCGGCTCGCTCGAGACGGCCGCCAACCCTTTCATCACCGGTACGTTTCCTACGGCTTC
GTTCCCCCTTTCTCGGTCACCCCTTCTTCGCGTATCGTTCTGGCGTCCGCTCGTCTGACGAGATGGCCAGTGTGC
GGCCCGCCCAAGTACTCCGAGATCCGCATCAACATCTCGCAGGCCTTCAACGGCATAGGCACCGTCATCGCCCCC
GTCCTCGGCTCGTACGTCTTCTTCAAGTTCAGCGATGAGCACGCGCTCGACAACGTGCAGTGGGTCTACCTCTCC
ATCGCCGTCTTCGTCCTCGTCCTGGCCGCCGCCTTCTTCTTCGCCGACATTCCCGAGATCACCGATGCCGGTAAG
TCCCAACTGTCCCCCCCCCCCCTTTTTTTTGTTAGCCCCTTTTCCCCCGTCCACCCCCCTTTTTTTTTCAAAGGG
GCATAGAGAGAGAGAGAGGGAGAAAGACAGGAGAGAAGGAGAGGGAGAAAGACAGGAGAGAGAGAGAGACAGAAA
GAAGAGTTCTAACGAAAGGGGGTGGGCCACCAAAACAGACATGGCGTTCCAGGCGCAGGAGACGCTCGCGAGCGA
CGACAAGCCGTTCCGGCAGCAGTACCGGCTCTTCCACGCGGCCTTTGCGCAGTTCTGCTACACGGGCGCGCAGGT
GGCCATCGCCAGCTTCTTCATCAACTACGCGAGCGCGACGCGGCCCGGGACGGACAGCGCGCTGGCGGCCAAGCT
GCTGGCGGGCGCGCAGGCCGCCTTCACCCTCGGCCGCTTCCTCGGCGTCGGCCTGATGCGGCTGGCCCGGCCGCG
GCTCGTCTTCCTCGTCTTCCTCTCCTGCTGCATCGTCTTCATCGGCCCGACCATCACGCAGCGCGGCGACGTCGG
CGTCGCCCTCCTCTTCGTCGTCCTCTTCTTCGAGTCCATCTGCTTCCCGACCATTGTCGCGCTCGGCATGCGCGG
CCTCGGCCGTCACACCAAGCGCGGCAGCGGCTACATCGTCGGCGGCGTCGTCGGCGGCGCCTGCGTGCCTCCGCT
GGCCGGCCTCGCCGGCGACCGCCACGGCGATGGCGTCGCCATGGTCGTGCCTCTCGTCTTCTTCGTCGCCGCCTG
GTCGTACGCCCTGTGCGTCAACTTCGTCCCGGCCTACACCCGAGTCCTCGACTCCGTCGCCGACGCCGACCACCG
GCCCCGCGAGCCCCAGTCTCCCGTCGACGCCTTCGGCGGCCCGGCCTTGGCCTCCACCGAAAAGGTCGGCCAGGA
GGAGCGCGTCTCGGCGCGGGCAGTATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail