Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10533
Gene name
LocationContig_86:36960..39363
Strand+
Gene length (bp)2403
Transcript length (bp)2265
Coding sequence length (bp)2265
Protein length (aa) 755

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05285 SDA1 SDA1 2.8E-95 421 747
PF08158 NUC130_3NT NUC130/3NT domain 1.5E-22 70 120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10342|SDA1_SCHPO Protein sda1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sda1 PE=3 SV=2 1 746 4.0E-176
sp|P53313|SDA1_YEAST Protein SDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDA1 PE=1 SV=1 1 748 1.0E-159
sp|Q9NVU7|SDA1_HUMAN Protein SDA1 homolog OS=Homo sapiens GN=SDAD1 PE=1 SV=3 11 738 1.0E-113
sp|A5D7C2|SDA1_BOVIN Protein SDA1 homolog OS=Bos taurus GN=SDAD1 PE=2 SV=1 11 738 6.0E-107
sp|Q5XIQ5|SDA1_RAT Protein SDA1 homolog OS=Rattus norvegicus GN=Sdad1 PE=1 SV=1 11 738 2.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10342|SDA1_SCHPO Protein sda1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sda1 PE=3 SV=2 1 746 4.0E-176
sp|P53313|SDA1_YEAST Protein SDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDA1 PE=1 SV=1 1 748 1.0E-159
sp|Q9NVU7|SDA1_HUMAN Protein SDA1 homolog OS=Homo sapiens GN=SDAD1 PE=1 SV=3 11 738 1.0E-113
sp|A5D7C2|SDA1_BOVIN Protein SDA1 homolog OS=Bos taurus GN=SDAD1 PE=2 SV=1 11 738 6.0E-107
sp|Q5XIQ5|SDA1_RAT Protein SDA1 homolog OS=Rattus norvegicus GN=Sdad1 PE=1 SV=1 11 738 2.0E-106
sp|Q80UZ2|SDA1_MOUSE Protein SDA1 homolog OS=Mus musculus GN=Sdad1 PE=1 SV=1 11 738 1.0E-103
sp|Q6NV26|SDA1_DANRE Protein SDA1 homolog OS=Danio rerio GN=sdad1 PE=2 SV=1 11 738 2.0E-103
sp|A7S6A5|SDA1_NEMVE Protein SDA1 homolog OS=Nematostella vectensis GN=sdad1 PE=3 SV=1 11 746 4.0E-103
sp|Q2VPG3|SDA1_XENLA Protein SDA1 homolog OS=Xenopus laevis GN=sdad1 PE=2 SV=1 11 738 5.0E-96
sp|A4IIB1|SDA1_XENTR Protein SDA1 homolog OS=Xenopus tropicalis GN=sdad1 PE=2 SV=1 11 738 5.0E-95
sp|Q55DE2|SDA1_DICDI Protein SDA1 homolog OS=Dictyostelium discoideum GN=sdad1 PE=3 SV=1 15 496 3.0E-94
sp|Q7KKH3|SDA1_DROME Protein SDA1 homolog OS=Drosophila melanogaster GN=Mys45A PE=1 SV=1 15 558 4.0E-93
sp|Q9NEU2|SDA1_CAEEL Protein SDA1 homolog OS=Caenorhabditis elegans GN=pro-3 PE=1 SV=4 19 466 3.0E-70
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10533
MGKRKVAALEKIDADFASLQYKIRRDPKSYKDDFLKQWEQYESQREIFLASPTTATTGSVESFHNMIDLIAHVAD
CYPDETRTFPDDLKAMLTQHHAAMHPELREKVVGSLVLLRRKDVIDSAGVLTTLFPILVSSPSKTLRELLFNKIL
SDLRNSNSKAINHPLNRTIQTVLYNLVTADRASPRAIWAIKLTRELWKRQIWTDAKPVDVMKEACLADNEKVVVG
AVRFFLGGDKEREELEDESSDDDIDLSKVRHQIGINKKSKKQKEAYKKAVGKVKRNERKKSKPHPLNFSALHLLH
DPQDFAEQLFSKHLHNTKAKLSLDSKILVLQLVTRLIGLHRLTVVPVYSWFIKYLTPRQQSVTSFLASLAQGTHD
LVPPDVLEPLLQKIANEFVSEASASEVAAAGLNAIREVCARQPLAMTETLLQDLVQYRKSKDKGVMMAAKGLLSL
YREVGAELLKKRDRGKEATIGLKAGLQQQRKFGDEQAGGIEGLDLLAKWKEEEKKRKRAERGLPETAGSDEDEKE
DEEDGFNSSDWEVDSDNSSSSGEWINVSDSEDERPAPKKQKKMKNQRKGDGPDGDDDDSSDDEGGENDDGDREAE
LERMSKLATTTILTPADLAKLQELRAAASIENAMGHRRKKAQGGDARHVDDGVTAENIEAPARLRKLTKEEKVAL
AKEGKPDREEHKSTQAIRKSKKEAAGKSTSNREKQRKKNFLMTLGKAKSKQKRSLVETRKVLRGHVERSSRGGRR
RNGG*
Coding >Hirsu2|10533
ATGGGGAAGCGAAAAGTTGCGGCACTCGAGAAGATCGATGCAGACTTCGCGAGCCTGCAATACAAGATCCGGCGC
GACCCCAAATCGTACAAGGACGACTTTCTGAAGCAGTGGGAGCAGTATGAGTCCCAGCGCGAAATCTTCCTGGCG
TCCCCGACCACGGCCACGACCGGCTCGGTGGAATCCTTCCACAACATGATCGACCTGATCGCGCACGTCGCCGAC
TGCTACCCCGACGAGACGCGGACCTTCCCCGACGACCTCAAAGCCATGCTGACACAGCATCACGCTGCCATGCAC
CCAGAGCTGCGCGAAAAGGTCGTTGGCAGCCTCGTGCTGCTGCGGCGCAAGGACGTCATCGACTCGGCCGGCGTC
CTCACCACCCTCTTCCCCATCCTGGTCTCTTCGCCGAGCAAGACTCTGCGCGAGCTGCTCTTCAACAAGATCCTG
AGCGATCTGCGCAACTCCAACTCCAAGGCCATCAACCACCCGCTCAACCGCACGATCCAGACCGTCCTGTACAAT
CTCGTCACCGCCGACCGAGCCTCGCCCCGCGCCATCTGGGCCATCAAGCTGACTCGCGAACTGTGGAAGCGACAA
ATATGGACGGATGCGAAGCCCGTTGACGTCATGAAGGAGGCCTGCCTGGCCGACAACGAAAAGGTCGTCGTCGGC
GCCGTGCGCTTCTTCCTCGGCGGCGACAAGGAGCGCGAGGAGCTCGAGGACGAGAGCAGCGACGACGACATTGAC
CTGTCCAAGGTCAGGCACCAGATCGGCATCAACAAGAAGTCGAAGAAGCAGAAGGAGGCGTACAAGAAAGCCGTC
GGCAAGGTCAAGAGGAACGAACGCAAGAAGAGCAAGCCCCATCCGCTCAACTTTTCCGCCCTCCACCTGCTTCAC
GATCCGCAAGACTTCGCCGAGCAGCTCTTCTCCAAACACCTTCACAACACCAAGGCCAAGCTGTCGCTCGACAGC
AAGATCCTGGTGCTACAGCTCGTCACGCGCCTGATCGGCCTCCACAGGCTGACCGTCGTGCCCGTATACTCCTGG
TTCATCAAGTACCTAACGCCACGGCAGCAATCCGTCACATCCTTCCTGGCCTCGCTTGCGCAGGGCACCCACGAC
CTCGTACCCCCCGATGTGCTTGAGCCGCTGCTCCAAAAGATTGCAAACGAGTTCGTCTCGGAAGCCTCGGCGTCC
GAGGTCGCCGCCGCCGGCCTCAACGCCATCCGAGAAGTCTGCGCCCGGCAGCCGCTGGCCATGACGGAAACCCTC
CTGCAGGACCTGGTGCAGTATCGCAAGAGCAAGGACAAGGGCGTCATGATGGCCGCCAAGGGGCTGCTGTCGCTG
TACAGAGAGGTGGGGGCCGAGCTGCTGAAGAAGAGGGACCGCGGAAAGGAGGCGACGATTGGCCTCAAGGCGGGC
CTGCAGCAACAGCGAAAGTTTGGCGATGAACAGGCCGGTGGCATCGAGGGCCTCGATTTGCTGGCGAAGTGGAAG
GAGGAGGAAAAGAAGAGGAAGCGGGCTGAGAGGGGGCTTCCGGAGACGGCCGGAAGTGATGAGGACGAGAAGGAG
GATGAGGAAGACGGTTTCAACTCGAGCGATTGGGAAGTCGATTCAGACAACAGCAGCAGCTCCGGGGAATGGATC
AATGTCAGCGATTCCGAGGACGAGCGACCGGCGCCCAAGAAGCAGAAGAAGATGAAGAACCAGAGGAAAGGCGAC
GGCCCTGACGGGGACGACGACGACAGCAGCGACGACGAAGGCGGCGAAAATGACGACGGGGACCGCGAAGCCGAG
CTCGAACGCATGTCCAAGCTAGCCACCACGACGATCCTCACGCCGGCGGACTTGGCGAAGCTGCAGGAACTCCGC
GCGGCAGCGTCCATCGAAAACGCCATGGGTCACCGCCGCAAGAAGGCGCAAGGCGGCGACGCGCGCCACGTCGAC
GACGGCGTGACGGCGGAGAATATCGAGGCGCCGGCCCGGCTGCGCAAGCTGACCAAGGAGGAGAAGGTGGCGCTG
GCCAAGGAGGGCAAGCCGGACCGGGAGGAGCACAAGAGCACGCAGGCGATCCGCAAGTCGAAGAAGGAGGCGGCA
GGCAAGAGCACGAGCAACCGCGAGAAGCAGCGCAAGAAGAACTTTCTGATGACGCTGGGCAAGGCCAAGAGCAAG
CAGAAGAGGAGCTTGGTGGAGACGAGAAAGGTGCTGAGGGGCCACGTCGAGAGGAGCTCGCGCGGAGGCCGCAGG
AGGAACGGCGGGTGA
Transcript >Hirsu2|10533
ATGGGGAAGCGAAAAGTTGCGGCACTCGAGAAGATCGATGCAGACTTCGCGAGCCTGCAATACAAGATCCGGCGC
GACCCCAAATCGTACAAGGACGACTTTCTGAAGCAGTGGGAGCAGTATGAGTCCCAGCGCGAAATCTTCCTGGCG
TCCCCGACCACGGCCACGACCGGCTCGGTGGAATCCTTCCACAACATGATCGACCTGATCGCGCACGTCGCCGAC
TGCTACCCCGACGAGACGCGGACCTTCCCCGACGACCTCAAAGCCATGCTGACACAGCATCACGCTGCCATGCAC
CCAGAGCTGCGCGAAAAGGTCGTTGGCAGCCTCGTGCTGCTGCGGCGCAAGGACGTCATCGACTCGGCCGGCGTC
CTCACCACCCTCTTCCCCATCCTGGTCTCTTCGCCGAGCAAGACTCTGCGCGAGCTGCTCTTCAACAAGATCCTG
AGCGATCTGCGCAACTCCAACTCCAAGGCCATCAACCACCCGCTCAACCGCACGATCCAGACCGTCCTGTACAAT
CTCGTCACCGCCGACCGAGCCTCGCCCCGCGCCATCTGGGCCATCAAGCTGACTCGCGAACTGTGGAAGCGACAA
ATATGGACGGATGCGAAGCCCGTTGACGTCATGAAGGAGGCCTGCCTGGCCGACAACGAAAAGGTCGTCGTCGGC
GCCGTGCGCTTCTTCCTCGGCGGCGACAAGGAGCGCGAGGAGCTCGAGGACGAGAGCAGCGACGACGACATTGAC
CTGTCCAAGGTCAGGCACCAGATCGGCATCAACAAGAAGTCGAAGAAGCAGAAGGAGGCGTACAAGAAAGCCGTC
GGCAAGGTCAAGAGGAACGAACGCAAGAAGAGCAAGCCCCATCCGCTCAACTTTTCCGCCCTCCACCTGCTTCAC
GATCCGCAAGACTTCGCCGAGCAGCTCTTCTCCAAACACCTTCACAACACCAAGGCCAAGCTGTCGCTCGACAGC
AAGATCCTGGTGCTACAGCTCGTCACGCGCCTGATCGGCCTCCACAGGCTGACCGTCGTGCCCGTATACTCCTGG
TTCATCAAGTACCTAACGCCACGGCAGCAATCCGTCACATCCTTCCTGGCCTCGCTTGCGCAGGGCACCCACGAC
CTCGTACCCCCCGATGTGCTTGAGCCGCTGCTCCAAAAGATTGCAAACGAGTTCGTCTCGGAAGCCTCGGCGTCC
GAGGTCGCCGCCGCCGGCCTCAACGCCATCCGAGAAGTCTGCGCCCGGCAGCCGCTGGCCATGACGGAAACCCTC
CTGCAGGACCTGGTGCAGTATCGCAAGAGCAAGGACAAGGGCGTCATGATGGCCGCCAAGGGGCTGCTGTCGCTG
TACAGAGAGGTGGGGGCCGAGCTGCTGAAGAAGAGGGACCGCGGAAAGGAGGCGACGATTGGCCTCAAGGCGGGC
CTGCAGCAACAGCGAAAGTTTGGCGATGAACAGGCCGGTGGCATCGAGGGCCTCGATTTGCTGGCGAAGTGGAAG
GAGGAGGAAAAGAAGAGGAAGCGGGCTGAGAGGGGGCTTCCGGAGACGGCCGGAAGTGATGAGGACGAGAAGGAG
GATGAGGAAGACGGTTTCAACTCGAGCGATTGGGAAGTCGATTCAGACAACAGCAGCAGCTCCGGGGAATGGATC
AATGTCAGCGATTCCGAGGACGAGCGACCGGCGCCCAAGAAGCAGAAGAAGATGAAGAACCAGAGGAAAGGCGAC
GGCCCTGACGGGGACGACGACGACAGCAGCGACGACGAAGGCGGCGAAAATGACGACGGGGACCGCGAAGCCGAG
CTCGAACGCATGTCCAAGCTAGCCACCACGACGATCCTCACGCCGGCGGACTTGGCGAAGCTGCAGGAACTCCGC
GCGGCAGCGTCCATCGAAAACGCCATGGGTCACCGCCGCAAGAAGGCGCAAGGCGGCGACGCGCGCCACGTCGAC
GACGGCGTGACGGCGGAGAATATCGAGGCGCCGGCCCGGCTGCGCAAGCTGACCAAGGAGGAGAAGGTGGCGCTG
GCCAAGGAGGGCAAGCCGGACCGGGAGGAGCACAAGAGCACGCAGGCGATCCGCAAGTCGAAGAAGGAGGCGGCA
GGCAAGAGCACGAGCAACCGCGAGAAGCAGCGCAAGAAGAACTTTCTGATGACGCTGGGCAAGGCCAAGAGCAAG
CAGAAGAGGAGCTTGGTGGAGACGAGAAAGGTGCTGAGGGGCCACGTCGAGAGGAGCTCGCGCGGAGGCCGCAGG
AGGAACGGCGGGTGA
Gene >Hirsu2|10533
ATGGGGAAGCGAAAAGTTGCGGCACTCGAGAAGATCGATGCAGACTTGTGCGTTCTCGTCTCATGCGTCCTCCCC
CATCTCTCTGCCAGCAACAGGAAACTGACCTGCCCCAGCGCGAGCCTGCAATACAAGATCCGGCGCGACCCCAAG
TGAGAGACGACTCAGACGAGGCAACCTGCCGCGACGGCGCGTATAGACGGCCGCTGACACCCTCGGTCTAGATCG
TACAAGGACGACTTTCTGAAGCAGTGGGAGCAGTATGAGTCCCAGCGCGAAATCTTCCTGGCGTCCCCGACCACG
GCCACGACCGGCTCGGTGGAATCCTTCCACAACATGATCGACCTGATCGCGCACGTCGCCGACTGCTACCCCGAC
GAGACGCGGACCTTCCCCGACGACCTCAAAGCCATGCTGACACAGCATCACGCTGCCATGCACCCAGAGCTGCGC
GAAAAGGTCGTTGGCAGCCTCGTGCTGCTGCGGCGCAAGGACGTCATCGACTCGGCCGGCGTCCTCACCACCCTC
TTCCCCATCCTGGTCTCTTCGCCGAGCAAGACTCTGCGCGAGCTGCTCTTCAACAAGATCCTGAGCGATCTGCGC
AACTCCAACTCCAAGGCCATCAACCACCCGCTCAACCGCACGATCCAGACCGTCCTGTACAATCTCGTCACCGCC
GACCGAGCCTCGCCCCGCGCCATCTGGGCCATCAAGCTGACTCGCGAACTGTGGAAGCGACAAATATGGACGGAT
GCGAAGCCCGTTGACGTCATGAAGGAGGCCTGCCTGGCCGACAACGAAAAGGTCGTCGTCGGCGCCGTGCGCTTC
TTCCTCGGCGGCGACAAGGAGCGCGAGGAGCTCGAGGACGAGAGCAGCGACGACGACATTGACCTGTCCAAGGTC
AGGCACCAGATCGGCATCAACAAGAAGTCGAAGAAGCAGAAGGAGGCGTACAAGAAAGCCGTCGGCAAGGTCAAG
AGGAACGAACGCAAGAAGAGCAAGCCCCATCCGCTCAACTTTTCCGCCCTCCACCTGCTTCACGATCCGCAAGAC
TTCGCCGAGCAGCTCTTCTCCAAACACCTTCACAACACCAAGGCCAAGCTGTCGCTCGACAGCAAGATCCTGGTG
CTACAGCTCGTCACGCGCCTGATCGGCCTCCACAGGCTGACCGTCGTGCCCGTATACTCCTGGTTCATCAAGTAC
CTAACGCCACGGCAGCAATCCGTCACATCCTTCCTGGCCTCGCTTGCGCAGGGCACCCACGACCTCGTACCCCCC
GATGTGCTTGAGCCGCTGCTCCAAAAGATTGCAAACGAGTTCGTCTCGGAAGCCTCGGCGTCCGAGGTCGCCGCC
GCCGGCCTCAACGCCATCCGAGAAGTCTGCGCCCGGCAGCCGCTGGCCATGACGGAAACCCTCCTGCAGGACCTG
GTGCAGTATCGCAAGAGCAAGGACAAGGGCGTCATGATGGCCGCCAAGGGGCTGCTGTCGCTGTACAGAGAGGTG
GGGGCCGAGCTGCTGAAGAAGAGGGACCGCGGAAAGGAGGCGACGATTGGCCTCAAGGCGGGCCTGCAGCAACAG
CGAAAGTTTGGCGATGAACAGGCCGGTGGCATCGAGGGCCTCGATTTGCTGGCGAAGTGGAAGGAGGAGGAAAAG
AAGAGGAAGCGGGCTGAGAGGGGGCTTCCGGAGACGGCCGGAAGTGATGAGGACGAGAAGGAGGATGAGGAAGAC
GGTTTCAACTCGAGCGATTGGGAAGTCGATTCAGACAACAGCAGCAGCTCCGGGGAATGGATCAATGTCAGCGAT
TCCGAGGACGAGCGACCGGCGCCCAAGAAGCAGAAGAAGATGAAGAACCAGAGGAAAGGCGACGGCCCTGACGGG
GACGACGACGACAGCAGCGACGACGAAGGCGGCGAAAATGACGACGGGGACCGCGAAGCCGAGCTCGAACGCATG
TCCAAGCTAGCCACCACGACGATCCTCACGCCGGCGGACTTGGCGAAGCTGCAGGAACTCCGCGCGGCAGCGTCC
ATCGAAAACGCCATGGGTCACCGCCGCAAGAAGGCGCAAGGCGGCGACGCGCGCCACGTCGACGACGGCGTGACG
GCGGAGAATATCGAGGCGCCGGCCCGGCTGCGCAAGCTGACCAAGGAGGAGAAGGTGGCGCTGGCCAAGGAGGGC
AAGCCGGACCGGGAGGAGCACAAGAGCACGCAGGCGATCCGCAAGTCGAAGAAGGAGGCGGCAGGCAAGAGCACG
AGCAACCGCGAGAAGCAGCGCAAGAAGAACTTTCTGATGACGCTGGGCAAGGCCAAGAGCAAGCAGAAGAGGAGC
TTGGTGGAGACGAGAAAGGTGCTGAGGGGCCACGTCGAGAGGAGCTCGCGCGGAGGCCGCAGGAGGAACGGCGGG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail