Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1053
Gene name
LocationContig_1219:41..779
Strand+
Gene length (bp)738
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06658 DUF1168 Protein of unknown function (DUF1168) 4.4E-35 43 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZKU0|PKRI1_CHICK PRKR-interacting protein 1 homolog OS=Gallus gallus GN=PRKRIP1 PE=2 SV=1 29 113 4.0E-14
sp|Q2KIT1|PKRI1_BOVIN PRKR-interacting protein 1 OS=Bos taurus GN=PRKRIP1 PE=2 SV=1 29 123 4.0E-14
sp|Q6GNG8|PKRI1_XENLA PRKR-interacting protein 1 homolog OS=Xenopus laevis GN=prkrip1 PE=2 SV=1 42 132 2.0E-13
sp|Q5R5J3|PKRI1_PONAB PRKR-interacting protein 1 OS=Pongo abelii GN=PRKRIP1 PE=2 SV=1 29 113 4.0E-13
sp|Q9H875|PKRI1_HUMAN PRKR-interacting protein 1 OS=Homo sapiens GN=PRKRIP1 PE=1 SV=1 29 113 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZKU0|PKRI1_CHICK PRKR-interacting protein 1 homolog OS=Gallus gallus GN=PRKRIP1 PE=2 SV=1 29 113 4.0E-14
sp|Q2KIT1|PKRI1_BOVIN PRKR-interacting protein 1 OS=Bos taurus GN=PRKRIP1 PE=2 SV=1 29 123 4.0E-14
sp|Q6GNG8|PKRI1_XENLA PRKR-interacting protein 1 homolog OS=Xenopus laevis GN=prkrip1 PE=2 SV=1 42 132 2.0E-13
sp|Q5R5J3|PKRI1_PONAB PRKR-interacting protein 1 OS=Pongo abelii GN=PRKRIP1 PE=2 SV=1 29 113 4.0E-13
sp|Q9H875|PKRI1_HUMAN PRKR-interacting protein 1 OS=Homo sapiens GN=PRKRIP1 PE=1 SV=1 29 113 4.0E-13
sp|Q9CWV6|PKRI1_MOUSE PRKR-interacting protein 1 OS=Mus musculus GN=Prkrip1 PE=1 SV=2 10 113 4.0E-13
sp|Q28IN9|PKRI1_XENTR PRKR-interacting protein 1 homolog OS=Xenopus tropicalis GN=prkrip1 PE=2 SV=1 44 132 4.0E-12
sp|Q568A0|PKRI1_DANRE PRKR-interacting protein 1 homolog OS=Danio rerio GN=prkrip1 PE=2 SV=1 42 112 8.0E-12
sp|P41880|YPT2_CAEEL Uncharacterized protein F37A4.2 OS=Caenorhabditis elegans GN=F37A4.2 PE=4 SV=1 47 101 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003725 double-stranded RNA binding Yes
GO:0003723 RNA binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1907 0.9248 0.0275 0.0139 0.3362 0.0045 0.0175 0.0064 0.0064 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1269
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7511
Ophiocordyceps australis map64 (Brazil) OphauB2|2368
Ophiocordyceps camponoti-floridani Ophcf2|05707
Ophiocordyceps camponoti-rufipedis Ophun1|288
Ophiocordyceps kimflemingae Ophio5|6464
Ophiocordyceps subramaniannii Hirsu2|1053 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1053
MSGEGPESIPTSADPRSRRPTKKRALSPASAQAAHVGALFAKPEREIRVPSSAAPRRPVRPAPPEIITNVQGSSA
GAGSGEFHVYKASRRREYERLRDMDADLQRQRAREQFEADRDDRLRRDERKTSKNRLKRDKAKARKANNNGDGNG
GNGGNGGNGGNGGGGNGNRVLARAPAPPITTTTTTTHDDADDASSATPATTSAGAEAESSLSSGQSSRLRDGGDD
DATATSTPANSGGLVIHDDD*
Coding >Hirsu2|1053
ATGTCGGGCGAAGGCCCCGAGTCGATCCCGACGTCAGCCGACCCGCGCTCGCGCCGGCCGACGAAGAAGCGCGCG
CTGTCGCCGGCCTCGGCGCAGGCGGCCCACGTCGGCGCCCTGTTCGCCAAGCCGGAGCGCGAGATACGCGTGCCG
TCGTCGGCCGCGCCCAGGCGGCCCGTCCGCCCCGCGCCCCCCGAGATCATCACCAACGTCCAGGGCTCGAGCGCC
GGCGCCGGCTCCGGCGAGTTCCACGTCTACAAGGCCTCGCGCCGCCGCGAGTACGAGCGCCTGCGCGACATGGAC
GCCGACCTGCAGCGCCAGCGCGCCCGCGAGCAGTTCGAGGCCGACCGTGACGACCGCCTGCGCCGCGACGAGCGC
AAGACGAGCAAGAACCGGCTGAAGAGGGACAAGGCCAAGGCCAGAAAGGCCAACAACAACGGCGACGGCAACGGC
GGCAACGGCGGCAACGGCGGCAACGGCGGCAACGGCGGCGGCGGCAACGGCAATCGAGTCCTGGCCAGGGCTCCC
GCCCCCCCTATCACCACCACCACCACCACCACCCACGACGACGCGGATGATGCTTCCTCCGCGACTCCAGCGACT
ACCTCCGCCGGCGCCGAAGCCGAAAGCTCCCTCTCGTCGGGCCAGTCCAGCCGTCTGCGCGACGGCGGTGACGAC
GATGCGACCGCCACATCGACCCCGGCCAATTCCGGGGGCCTCGTCATCCACGACGACGATTGA
Transcript >Hirsu2|1053
ATGTCGGGCGAAGGCCCCGAGTCGATCCCGACGTCAGCCGACCCGCGCTCGCGCCGGCCGACGAAGAAGCGCGCG
CTGTCGCCGGCCTCGGCGCAGGCGGCCCACGTCGGCGCCCTGTTCGCCAAGCCGGAGCGCGAGATACGCGTGCCG
TCGTCGGCCGCGCCCAGGCGGCCCGTCCGCCCCGCGCCCCCCGAGATCATCACCAACGTCCAGGGCTCGAGCGCC
GGCGCCGGCTCCGGCGAGTTCCACGTCTACAAGGCCTCGCGCCGCCGCGAGTACGAGCGCCTGCGCGACATGGAC
GCCGACCTGCAGCGCCAGCGCGCCCGCGAGCAGTTCGAGGCCGACCGTGACGACCGCCTGCGCCGCGACGAGCGC
AAGACGAGCAAGAACCGGCTGAAGAGGGACAAGGCCAAGGCCAGAAAGGCCAACAACAACGGCGACGGCAACGGC
GGCAACGGCGGCAACGGCGGCAACGGCGGCAACGGCGGCGGCGGCAACGGCAATCGAGTCCTGGCCAGGGCTCCC
GCCCCCCCTATCACCACCACCACCACCACCACCCACGACGACGCGGATGATGCTTCCTCCGCGACTCCAGCGACT
ACCTCCGCCGGCGCCGAAGCCGAAAGCTCCCTCTCGTCGGGCCAGTCCAGCCGTCTGCGCGACGGCGGTGACGAC
GATGCGACCGCCACATCGACCCCGGCCAATTCCGGGGGCCTCGTCATCCACGACGACGATTGA
Gene >Hirsu2|1053
ATGTCGGGCGAAGGCCCCGAGTCGATCCCGACGTCAGCCGACCCGCGCTCGCGCCGGCCGACGAAGAAGCGCGCG
CTGTCGCCGGCCTCGGCGCAGGCGGCCCACGTCGGCGCCCTGTTCGCCAAGCCGGAGCGCGAGATACGCGTGCCG
TCGTCGGCCGCGCCCAGGCGGCCCGTCCGCCCCGCGCCCCCCGAGATCATCACCAACGTCCAGGGCTCGAGCGCC
GGCGCCGGCTCCGGCGAGTTCCACGTCTACAAGGCCTCGCGCCGCCGCGAGTACGAGCGCCTGCGCGACATGGAC
GCCGACCTGCAGCGCCAGCGCGCCCGCGAGCAGTTCGAGGCCGACCGTGACGACCGCCTGCGCCGCGACGAGCGC
AAGACGAGCAAGAACCGGCTGAAGAGGGACAAGGCCAAGGCCAGAAAGGCCAACAACAACGGCGACGGCAACGGC
GGCAACGGCGGCAACGGCGGCAACGGCGGCAACGGCGGCGGCGGCAACGGCAATCGAGTCCTGGCCAGGGCTCCC
GCCCCCCCTATCACCACCACCACCACCACCACCCACGACGACGCGGATGATGCTTCCTCCGCGACTCCAGCGACT
ACCTCCGCCGGCGCCGAAGCCGAAAGCTCCCTCTCGTCGGGCCAGTCCAGCCGTCTGCGCGACGGCGGTGACGAC
GATGCGACCGCCACATCGACCCCGGCCAATTCCGGGGGCCTCGTCATCCACGACGACGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail