Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10521
Gene name
LocationContig_86:8640..10886
Strand-
Gene length (bp)2246
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 7.1E-06 624 655
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.5E-09 584 673
PF00023 Ank Ankyrin repeat 1.6E-03 602 640
PF00023 Ank Ankyrin repeat 1.1E-03 643 673
PF13857 Ank_5 Ankyrin repeats (many copies) 2.3E-08 629 683
PF13606 Ank_3 Ankyrin repeat 2.9E-03 643 670

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 524 683 1.0E-09
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 524 683 6.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 524 680 1.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 560 684 3.0E-08
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 566 676 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 524 683 1.0E-09
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 524 683 6.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 524 680 1.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 560 684 3.0E-08
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 566 676 7.0E-08
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 560 684 9.0E-08
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 354 683 4.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 577 686 9.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 576 683 1.0E-06
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 581 683 2.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 575 683 4.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 624 703 5.0E-06
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 521 686 6.0E-06
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 521 686 6.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 624 703 6.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 347 683 7.0E-06
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 582 700 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10521
MLQLSPPRLAIPASSPSPSGASTPTGRPSMWTASAQRKMARLYVYTTLPLEVIVKLVHYRFPHSAPGLDSANKKL
SSLLDKEPRWLHPRNESDMGRRLTQLSNSQPRLASAEEIASCSPLAAADDGISLSPPGPFCVKSETPTSPMARGV
SPSDSVPSLLGSPLPFSTSPLSSTENLPSLFSGAASHDERPEDAGAFSSFLRRTTCLSASTEGTTESFRQILRGY
SDPYVRTVKRLVKRFTAPMTARSSPSPLLEGSVSRLPSSSPGDQDGPSTFGDEPRLLPGDFLSLDLLVGGGVCCA
LPEAHRRRRCICFDQFDDDSSPWINTGGLTSAGQRLMAMRPTRADFDEVDSFGNTVLHFLAARGLMELLPQVLQA
GFCDAILNDRNTAGQTFLHVAKRSEVRDVNRFHNLLYLAFCRGFDVGAVDVYGRSISHVLRVAGVSSEAILRICP
HVQARRFNSRDAFGAKPVQEHVALEHRPESMDVDPSPDPLRPATTCTSRSIDGTITREARLLEVVRLAREDPLLE
DEDGRNGLHCLASATLSADSVADKYGLDPGPADEAAGGRRKAERQLDSGSAALKFRLSLATGLVEAGVEANHYDG
RGETPLMAFAAELPEEGDHRTGPEILALLIRHGADVRARNRSGETALHVAVRRGRKLAMRTLVEHGASVHARDAD
GRSVLDVADAQMLAGDPRQYARYEACRAWLSSSRGLAVQRPTAFDEWRR*
Coding >Hirsu2|10521
ATGCTGCAGCTATCGCCGCCGCGGCTCGCCATCCCGGCCTCGTCGCCGTCTCCGTCCGGTGCCAGCACGCCGACC
GGCCGGCCTTCCATGTGGACGGCCTCGGCCCAGCGCAAGATGGCTCGCCTCTACGTCTATACCACCTTGCCGCTC
GAGGTCATCGTCAAGCTCGTCCACTATCGCTTTCCGCACTCGGCTCCTGGCCTCGACTCGGCCAATAAGAAGCTC
AGCTCGTTGCTCGACAAGGAGCCGCGATGGCTTCATCCGCGCAACGAATCCGACATGGGCCGCCGCCTGACCCAG
CTTTCCAACTCGCAGCCCCGGCTCGCGTCTGCCGAGGAGATCGCGTCCTGCAGTCCGCTCGCCGCCGCCGACGAC
GGCATTTCGCTCTCGCCCCCGGGCCCGTTTTGCGTCAAATCAGAAACGCCGACCAGCCCGATGGCGCGGGGCGTA
TCGCCGTCCGACTCCGTTCCGAGCCTTCTCGGAAGCCCGCTGCCTTTTTCGACGAGCCCCCTTTCCTCGACGGAG
AACCTTCCTTCTCTCTTCAGCGGCGCTGCTTCCCACGACGAGCGTCCGGAAGATGCCGGCGCCTTCTCCTCCTTC
CTCCGGCGCACAACCTGCCTGTCCGCCTCGACCGAGGGCACGACCGAATCCTTTCGCCAAATCCTCCGCGGCTAC
TCAGACCCGTATGTCCGGACCGTCAAGAGGCTGGTCAAGAGGTTTACGGCGCCAATGACCGCCAGGTCCAGTCCG
TCCCCCTTGCTGGAGGGGAGCGTTTCGCGCCTGCCATCATCATCGCCTGGCGATCAAGACGGTCCCAGCACATTC
GGCGACGAGCCGCGCCTCTTGCCCGGAGACTTTCTCAGCCTCGACCTGCTGGTCGGCGGCGGTGTTTGCTGTGCG
CTGCCGGAAGCTCACCGGCGCAGGCGGTGCATATGTTTCGACCAGTTCGACGACGATTCTTCGCCCTGGATCAAC
ACGGGCGGGTTGACCTCTGCTGGCCAGCGTCTGATGGCCATGCGGCCGACGCGTGCAGACTTTGACGAGGTTGAT
TCCTTTGGCAATACGGTGCTGCATTTTCTCGCCGCTCGGGGCCTGATGGAGCTGCTGCCGCAAGTCCTCCAGGCG
GGTTTTTGCGATGCCATCCTGAACGACAGGAACACGGCGGGCCAGACGTTCTTGCACGTGGCCAAGCGGAGCGAG
GTGCGGGACGTGAACCGCTTCCACAACCTCCTGTATCTGGCTTTCTGCCGAGGCTTCGACGTTGGTGCAGTCGAT
GTCTACGGGCGCAGCATCTCGCACGTGCTACGGGTGGCGGGCGTATCCTCGGAGGCGATACTGCGGATTTGCCCT
CATGTCCAAGCCCGGCGATTCAACAGCCGCGATGCCTTCGGAGCCAAGCCGGTCCAGGAGCACGTGGCGCTCGAG
CATCGTCCCGAGTCGATGGACGTGGATCCGAGCCCTGACCCGCTCCGCCCGGCGACGACCTGCACGAGTCGGAGC
ATCGACGGTACGATAACGCGAGAGGCCCGACTGTTGGAAGTCGTCAGGCTCGCGCGCGAGGATCCGCTGCTGGAG
GATGAGGACGGGCGCAACGGCCTGCACTGCCTCGCCAGCGCGACCCTAAGCGCCGACAGCGTGGCGGACAAGTAC
GGCCTGGACCCGGGCCCGGCGGACGAGGCGGCGGGCGGCAGGCGCAAGGCGGAGCGGCAGCTGGACTCGGGCAGC
GCGGCGCTCAAGTTCCGCCTCTCGCTCGCGACGGGGCTCGTCGAGGCCGGCGTGGAGGCGAACCACTACGACGGG
CGCGGCGAGACGCCGCTGATGGCCTTCGCGGCCGAGCTGCCGGAGGAGGGCGACCACCGGACGGGGCCCGAGATC
CTGGCGCTGCTGATCCGGCACGGGGCCGACGTCCGGGCGCGGAACCGGTCGGGCGAGACGGCGCTGCACGTGGCC
GTCCGCCGCGGGCGCAAGCTGGCGATGCGCACGCTCGTCGAGCACGGGGCCAGCGTGCACGCGCGCGACGCCGAC
GGCCGCAGCGTGCTCGACGTCGCCGACGCCCAGATGCTCGCCGGCGACCCGCGCCAATACGCCCGCTACGAGGCC
TGCCGCGCCTGGCTCAGCAGCAGCAGGGGCCTCGCCGTCCAGCGGCCGACGGCCTTTGACGAGTGGCGACGCTGA
Transcript >Hirsu2|10521
ATGCTGCAGCTATCGCCGCCGCGGCTCGCCATCCCGGCCTCGTCGCCGTCTCCGTCCGGTGCCAGCACGCCGACC
GGCCGGCCTTCCATGTGGACGGCCTCGGCCCAGCGCAAGATGGCTCGCCTCTACGTCTATACCACCTTGCCGCTC
GAGGTCATCGTCAAGCTCGTCCACTATCGCTTTCCGCACTCGGCTCCTGGCCTCGACTCGGCCAATAAGAAGCTC
AGCTCGTTGCTCGACAAGGAGCCGCGATGGCTTCATCCGCGCAACGAATCCGACATGGGCCGCCGCCTGACCCAG
CTTTCCAACTCGCAGCCCCGGCTCGCGTCTGCCGAGGAGATCGCGTCCTGCAGTCCGCTCGCCGCCGCCGACGAC
GGCATTTCGCTCTCGCCCCCGGGCCCGTTTTGCGTCAAATCAGAAACGCCGACCAGCCCGATGGCGCGGGGCGTA
TCGCCGTCCGACTCCGTTCCGAGCCTTCTCGGAAGCCCGCTGCCTTTTTCGACGAGCCCCCTTTCCTCGACGGAG
AACCTTCCTTCTCTCTTCAGCGGCGCTGCTTCCCACGACGAGCGTCCGGAAGATGCCGGCGCCTTCTCCTCCTTC
CTCCGGCGCACAACCTGCCTGTCCGCCTCGACCGAGGGCACGACCGAATCCTTTCGCCAAATCCTCCGCGGCTAC
TCAGACCCGTATGTCCGGACCGTCAAGAGGCTGGTCAAGAGGTTTACGGCGCCAATGACCGCCAGGTCCAGTCCG
TCCCCCTTGCTGGAGGGGAGCGTTTCGCGCCTGCCATCATCATCGCCTGGCGATCAAGACGGTCCCAGCACATTC
GGCGACGAGCCGCGCCTCTTGCCCGGAGACTTTCTCAGCCTCGACCTGCTGGTCGGCGGCGGTGTTTGCTGTGCG
CTGCCGGAAGCTCACCGGCGCAGGCGGTGCATATGTTTCGACCAGTTCGACGACGATTCTTCGCCCTGGATCAAC
ACGGGCGGGTTGACCTCTGCTGGCCAGCGTCTGATGGCCATGCGGCCGACGCGTGCAGACTTTGACGAGGTTGAT
TCCTTTGGCAATACGGTGCTGCATTTTCTCGCCGCTCGGGGCCTGATGGAGCTGCTGCCGCAAGTCCTCCAGGCG
GGTTTTTGCGATGCCATCCTGAACGACAGGAACACGGCGGGCCAGACGTTCTTGCACGTGGCCAAGCGGAGCGAG
GTGCGGGACGTGAACCGCTTCCACAACCTCCTGTATCTGGCTTTCTGCCGAGGCTTCGACGTTGGTGCAGTCGAT
GTCTACGGGCGCAGCATCTCGCACGTGCTACGGGTGGCGGGCGTATCCTCGGAGGCGATACTGCGGATTTGCCCT
CATGTCCAAGCCCGGCGATTCAACAGCCGCGATGCCTTCGGAGCCAAGCCGGTCCAGGAGCACGTGGCGCTCGAG
CATCGTCCCGAGTCGATGGACGTGGATCCGAGCCCTGACCCGCTCCGCCCGGCGACGACCTGCACGAGTCGGAGC
ATCGACGGTACGATAACGCGAGAGGCCCGACTGTTGGAAGTCGTCAGGCTCGCGCGCGAGGATCCGCTGCTGGAG
GATGAGGACGGGCGCAACGGCCTGCACTGCCTCGCCAGCGCGACCCTAAGCGCCGACAGCGTGGCGGACAAGTAC
GGCCTGGACCCGGGCCCGGCGGACGAGGCGGCGGGCGGCAGGCGCAAGGCGGAGCGGCAGCTGGACTCGGGCAGC
GCGGCGCTCAAGTTCCGCCTCTCGCTCGCGACGGGGCTCGTCGAGGCCGGCGTGGAGGCGAACCACTACGACGGG
CGCGGCGAGACGCCGCTGATGGCCTTCGCGGCCGAGCTGCCGGAGGAGGGCGACCACCGGACGGGGCCCGAGATC
CTGGCGCTGCTGATCCGGCACGGGGCCGACGTCCGGGCGCGGAACCGGTCGGGCGAGACGGCGCTGCACGTGGCC
GTCCGCCGCGGGCGCAAGCTGGCGATGCGCACGCTCGTCGAGCACGGGGCCAGCGTGCACGCGCGCGACGCCGAC
GGCCGCAGCGTGCTCGACGTCGCCGACGCCCAGATGCTCGCCGGCGACCCGCGCCAATACGCCCGCTACGAGGCC
TGCCGCGCCTGGCTCAGCAGCAGCAGGGGCCTCGCCGTCCAGCGGCCGACGGCCTTTGACGAGTGGCGACGCTGA
Gene >Hirsu2|10521
ATGCTGCAGCTATCGCCGCCGCGGCTCGCCATCCCGGCCTCGTCGCCGTCTCCGTCCGGTGCCAGCACGCCGACC
GGCCGGCCTTCCATGTGGACGGCCTCGGCCCAGCGCAAGATGGCTCGCCTCTACGTCTATACCACCTTGCCGCTC
GAGGTCATCGTCAAGCTCGTCCACTATCGCTTTCCGCACTCGGCTCCTGGGTGAGTCGCCTGCGCTCTCCTCCGC
CCGGCCCGGTCCTCGTCTGACGCTCCCTCTTCTTGCTTGCCGGCAGCCTCGACTCGGCCAATAAGAAGCTCAGCT
CGTTGCTCGACAAGGAGCCGCGATGGCTTCATCCGCGCAACGAATCCGACATGGGCCGCCGCCTGACCCAGCTTT
CCAACTCGCAGCCCCGGCTCGCGTCTGCCGAGGAGATCGCGTCCTGCAGTCCGCTCGCCGCCGCCGACGACGGCA
TTTCGCTCTCGCCCCCGGGCCCGTTTTGCGTCAAATCAGAAACGCCGACCAGCCCGATGGCGCGGGGCGTATCGC
CGTCCGACTCCGTTCCGAGCCTTCTCGGAAGCCCGCTGCCTTTTTCGACGAGCCCCCTTTCCTCGACGGAGAACC
TTCCTTCTCTCTTCAGCGGCGCTGCTTCCCACGACGAGCGTCCGGAAGATGCCGGCGCCTTCTCCTCCTTCCTCC
GGCGCACAACCTGCCTGTCCGCCTCGACCGAGGGCACGACCGAATCCTTTCGCCAAATCCTCCGCGGCTACTCAG
ACCCGTATGTCCGGACCGTCAAGAGGCTGGTCAAGAGGTTTACGGCGCCAATGACCGCCAGGTCCAGTCCGTCCC
CCTTGCTGGAGGGGAGCGTTTCGCGCCTGCCATCATCATCGCCTGGCGATCAAGACGGTCCCAGCACATTCGGCG
ACGAGCCGCGCCTCTTGCCCGGAGACTTTCTCAGCCTCGACCTGCTGGTCGGCGGCGGTGTTTGCTGTGCGCTGC
CGGAAGCTCACCGGCGCAGGCGGTGCATATGTTTCGACCAGTTCGACGACGATTCTTCGCCCTGGATCAACACGG
GCGGGTTGACCTCTGCTGGCCAGCGTCTGATGGCCATGCGGCCGACGCGTGCAGACTTTGACGAGGTTGATTCCT
TTGGCAATACGGTGCTGCATTTTCTCGCCGCTCGGGGCCTGATGGAGCTGCTGCCGCAAGTCCTCCAGGCGGGTT
TTTGCGATGCCATCCTGAACGACAGGAACACGGCGGGCCAGACGTTCTTGCACGTGGCCAAGCGGAGCGAGGTGC
GGGACGTGAACCGCTTCCACAACCTCCTGTATCTGGCTTTCTGCCGAGGCTTCGACGTTGGTGCAGTCGATGTCT
ACGGGCGCAGCATCTCGCACGTGCTACGGGTGGCGGGCGTATCCTCGGAGGCGATACTGCGGATTTGCCCTCATG
TCCAAGCCCGGCGATTCAACAGCCGCGATGCCTTCGGAGCCAAGCCGGTCCAGGAGCACGTGGCGCTCGAGCATC
GTCCCGAGTCGATGGACGTGGATCCGAGCCCTGACCCGCTCCGCCCGGCGACGACCTGCACGAGTCGGAGCATCG
ACGGTACGATAACGCGAGAGGCCCGACTGTTGGAAGTCGTCAGGCTCGCGCGCGAGGATCCGCTGCTGGAGGATG
AGGACGGGCGCAACGGCCTGCACTGCCTCGCCAGCGCGACCCTAAGCGCCGACAGCGTGGCGGACAAGTACGGCC
TGGACCCGGGCCCGGCGGACGAGGCGGCGGGCGGCAGGCGCAAGGCGGAGCGGCAGCTGGACTCGGGCAGCGCGG
CGCTCAAGTTCCGCCTCTCGCTCGCGACGGGGCTCGTCGAGGCCGGCGTGGAGGCGAACCACTACGACGGGCGCG
GCGAGACGCCGCTGATGGCCTTCGCGGCCGAGCTGCCGGAGGAGGGCGACCACCGGACGGGGCCCGAGATCCTGG
CGCTGCTGATCCGGCACGGGGCCGACGTCCGGGCGCGGAACCGGTCGGGCGAGACGGCGCTGCACGTGGCCGTCC
GCCGCGGGCGCAAGCTGGCGATGCGCACGCTCGTCGAGCACGGGGCCAGCGTGCACGCGCGCGACGCCGACGGCC
GCAGCGTGCTCGACGTCGCCGACGCCCAGATGCTCGCCGGCGACCCGCGCCAATACGCCCGCTACGAGGCCTGCC
GCGCCTGGCTCAGCAGCAGCAGGGGCCTCGCCGTCCAGCGGCCGACGGCCTTTGACGAGTGGCGACGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail