Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10516
Gene name
LocationContig_86:51..1113
Strand+
Gene length (bp)1062
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04991 LicD LicD family 8.5E-18 114 231

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36044|MNN4_YEAST Protein MNN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN4 PE=4 SV=2 64 268 1.0E-20
sp|P40355|YJ31_YEAST Uncharacterized protein YJR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR061W PE=4 SV=2 47 224 2.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10516
MPSPRALVVAALLAGRGLGWSITPFLARHDAASSSEPAVLLSGRDSPAPDPPSPPAPPGEEAAAPALTPKYFHEP
GGSLARGHYDERFFREEMGYDEHRRVLRQLIRSYLATAARHGFETWLAHGTLLGWWWNGRAMPWDYDLDVQVSDA
TLRWMAARLNRTEHEFNATDADADSPDADSSGPRRYLLDVNPHHADLTRGDGMNIIDARWIDTANGMFVDITGLR
ERDPARPGLWSCKNMHRYASRDLWPMRLTEFEGARARIPYNVDRILADEYGPQCLVTEEHAGHRWDRDIKEWVMM
SPDEQQRRHHLVRERKRQQMIRDGRLPAP*
Coding >Hirsu2|10516
ATGCCTTCGCCCAGGGCCCTGGTCGTGGCCGCGCTCCTGGCCGGCCGCGGCCTCGGCTGGAGCATCACGCCCTTC
TTGGCCCGCCACGACGCCGCCTCCTCCTCCGAGCCGGCCGTGCTGCTGTCCGGCCGCGACTCGCCCGCGCCCGAC
CCGCCGTCGCCGCCCGCCCCCCCGGGAGAGGAAGCAGCGGCGCCGGCGCTGACGCCCAAGTACTTCCACGAGCCC
GGCGGCAGCCTGGCGCGCGGGCACTACGACGAGCGCTTCTTCCGCGAAGAGATGGGCTACGACGAGCACCGGCGC
GTGCTGCGGCAGCTGATCCGCAGCTACCTGGCGACGGCGGCCCGGCACGGCTTCGAGACGTGGCTGGCCCACGGC
ACGCTGCTGGGCTGGTGGTGGAACGGCCGGGCCATGCCGTGGGACTACGACCTCGACGTCCAGGTCTCGGACGCG
ACGCTGCGCTGGATGGCGGCGCGCCTCAACCGCACCGAGCACGAGTTCAACGCGACCGACGCCGACGCCGACTCG
CCCGACGCCGACTCGTCCGGCCCGCGCCGCTACCTGCTCGACGTCAACCCGCACCACGCCGACCTGACGCGCGGC
GACGGCATGAACATCATCGACGCCCGCTGGATCGACACGGCCAACGGCATGTTCGTCGACATCACCGGCCTGCGC
GAGCGCGACCCGGCCCGCCCCGGCCTCTGGAGCTGCAAGAACATGCACCGCTACGCCAGCCGCGACCTGTGGCCC
ATGCGCCTGACCGAGTTCGAGGGCGCCCGCGCCCGCATCCCCTACAACGTCGACCGCATCCTCGCCGACGAGTAC
GGGCCCCAGTGCCTCGTCACCGAGGAGCACGCCGGCCACCGCTGGGACCGCGACATCAAGGAATGGGTCATGATG
AGCCCCGACGAGCAGCAGCGCCGCCACCACCTGGTCCGCGAGCGCAAGCGCCAGCAGATGATTCGCGACGGCCGC
CTGCCCGCCCCCTGA
Transcript >Hirsu2|10516
ATGCCTTCGCCCAGGGCCCTGGTCGTGGCCGCGCTCCTGGCCGGCCGCGGCCTCGGCTGGAGCATCACGCCCTTC
TTGGCCCGCCACGACGCCGCCTCCTCCTCCGAGCCGGCCGTGCTGCTGTCCGGCCGCGACTCGCCCGCGCCCGAC
CCGCCGTCGCCGCCCGCCCCCCCGGGAGAGGAAGCAGCGGCGCCGGCGCTGACGCCCAAGTACTTCCACGAGCCC
GGCGGCAGCCTGGCGCGCGGGCACTACGACGAGCGCTTCTTCCGCGAAGAGATGGGCTACGACGAGCACCGGCGC
GTGCTGCGGCAGCTGATCCGCAGCTACCTGGCGACGGCGGCCCGGCACGGCTTCGAGACGTGGCTGGCCCACGGC
ACGCTGCTGGGCTGGTGGTGGAACGGCCGGGCCATGCCGTGGGACTACGACCTCGACGTCCAGGTCTCGGACGCG
ACGCTGCGCTGGATGGCGGCGCGCCTCAACCGCACCGAGCACGAGTTCAACGCGACCGACGCCGACGCCGACTCG
CCCGACGCCGACTCGTCCGGCCCGCGCCGCTACCTGCTCGACGTCAACCCGCACCACGCCGACCTGACGCGCGGC
GACGGCATGAACATCATCGACGCCCGCTGGATCGACACGGCCAACGGCATGTTCGTCGACATCACCGGCCTGCGC
GAGCGCGACCCGGCCCGCCCCGGCCTCTGGAGCTGCAAGAACATGCACCGCTACGCCAGCCGCGACCTGTGGCCC
ATGCGCCTGACCGAGTTCGAGGGCGCCCGCGCCCGCATCCCCTACAACGTCGACCGCATCCTCGCCGACGAGTAC
GGGCCCCAGTGCCTCGTCACCGAGGAGCACGCCGGCCACCGCTGGGACCGCGACATCAAGGAATGGGTCATGATG
AGCCCCGACGAGCAGCAGCGCCGCCACCACCTGGTCCGCGAGCGCAAGCGCCAGCAGATGATTCGCGACGGCCGC
CTGCCCGCCCCCTGA
Gene >Hirsu2|10516
ATGCCTTCGCCCAGGGCCCTGGTCGTGGCCGCGCTCCTGGCCGGCCGCGGCCTCGGCTGGAGCATCACGCCCTTC
TTGGCCCGCCACGACGCCGCCTCCTCCTCCGAGCCGGCCGTGCTGCTGTCCGGCCGCGACTCGCCCGCGCCCGAC
CCGCCGTCGCCGCCCGCCCCCCCGGGAGAGGAAGCAGCGGCGCCGGCGCTGACGCCCAAGTACTTCCACGAGCCC
GGCGGCAGCCTGGCGCGCGGGCACTACGACGAGCGCTTCTTCCGCGAAGAGATGGGCTACGACGAGCACCGGCGC
GTGCTGCGGCAGCTGATCCGCAGCTACCTGGCGACGGCGGCCCGGCACGGCTTCGAGACGTGGCTGGCCCACGGC
ACGCTGCTGGGCTGGTGGTGGAACGGCCGGGCCATGCCGTGGGACTACGACCTCGACGTCCAGGTCTCGGACGCG
ACGCTGCGCTGGATGGCGGCGCGCCTCAACCGCACCGAGCACGAGTTCAACGCGACCGACGCCGACGCCGACTCG
CCCGACGCCGACTCGTCCGGCCCGCGCCGCTACCTGCTCGACGTCAACCCGCACCACGCCGACCTGACGCGCGGC
GACGGCATGAACATCATCGACGCCCGCTGGATCGACACGGCCAACGGCATGTTCGTCGACATCACCGGCCTGCGC
GAGCGCGACCCGGCCCGCCCCGGCCTCTGGAGCTGCAAGAACATGCACCGCTACGCCAGCCGCGACCTGTGGCCC
ATGCGCCTGACCGAGTTCGAGGGCGCCCGCGCCCGCATCCCCTACAACGTCGACCGCATCCTCGCCGACGAGTAC
GGGCCCCAGTGCCTCGTCACCGAGGAGCACGCCGGGTCCGTTCTTCCCATCCTCCCCGTGCCGCTCTCGACGCCT
GTCTTGCTGACCTGACGGCCCCCTCGGGACAGCCACCGCTGGGACCGCGACATCAAGGAATGGGTCATGATGAGC
CCCGACGAGCAGCAGCGCCGCCACCACCTGGTCCGCGAGCGCAAGCGCCAGCAGATGATTCGCGACGGCCGCCTG
CCCGCCCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail