Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1051
Gene name
LocationContig_1217:4648..5202
Strand+
Gene length (bp)554
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 2.4E-10 25 89

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular|Cell membrane 0.0802 0.0297 0.725 0.5238 0.0957 0.0087 0.2451 0.1613 0.2101 0.0026

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7891
Ophiocordyceps australis map64 (Brazil) OphauB2|6400
Ophiocordyceps subramaniannii Hirsu2|1051 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1051
MKAAAPLAALAGLAAAAADLAALQKALPACSLVCLVQGVAEHGCAVADFACQCARLEPIIRTVAPCLVRAGCSLE
NITATARVVLDVCKNEVPDSVRVSAPEATAPAAAVSAAAATLWAPCLGGFAFAAAAAVLL*
Coding >Hirsu2|1051
ATGAAGGCCGCCGCCCCCCTCGCGGCGCTCGCCGGCCTCGCCGCCGCCGCCGCCGACCTGGCCGCGCTGCAGAAG
GCGCTGCCGGCGTGCTCGCTCGTGTGCCTCGTCCAGGGCGTCGCCGAACACGGCTGCGCCGTCGCCGACTTCGCC
TGCCAGTGCGCGCGCCTCGAGCCCATCATCCGCACCGTCGCGCCCTGCCTCGTCCGGGCCGGCTGCAGCCTGGAG
AACATCACCGCCACCGCCCGCGTCGTGCTCGACGTCTGCAAAAACGAGGTCCCAGACTCGGTCCGCGTCTCGGCC
CCCGAGGCAACGGCCCCCGCCGCCGCCGTCTCCGCTGCCGCCGCCACGCTTTGGGCGCCTTGCCTAGGTGGCTTT
GCTTTCGCCGCTGCCGCCGCTGTCTTGCTATGA
Transcript >Hirsu2|1051
ATGAAGGCCGCCGCCCCCCTCGCGGCGCTCGCCGGCCTCGCCGCCGCCGCCGCCGACCTGGCCGCGCTGCAGAAG
GCGCTGCCGGCGTGCTCGCTCGTGTGCCTCGTCCAGGGCGTCGCCGAACACGGCTGCGCCGTCGCCGACTTCGCC
TGCCAGTGCGCGCGCCTCGAGCCCATCATCCGCACCGTCGCGCCCTGCCTCGTCCGGGCCGGCTGCAGCCTGGAG
AACATCACCGCCACCGCCCGCGTCGTGCTCGACGTCTGCAAAAACGAGGTCCCAGACTCGGTCCGCGTCTCGGCC
CCCGAGGCAACGGCCCCCGCCGCCGCCGTCTCCGCTGCCGCCGCCACGCTTTGGGCGCCTTGCCTAGGTGGCTTT
GCTTTCGCCGCTGCCGCCGCTGTCTTGCTATGA
Gene >Hirsu2|1051
ATGAAGGCCGCCGCCCCCCTCGCGGCGCTCGCCGGCCTCGCCGCCGCCGCCGCCGACCTGGCCGCGCTGCAGAAG
GCGCTGCCGGCGTGCTCGCTCGTGTGCCTCGTCCAGGGCGTCGCCGAACACGGCTGCGCCGTCGCCGACTTCGCC
TGCCAGTGCGCGCGCCTCGAGCCCATCATCCGCACCGTCGCGCCCTGCCTCGTCCGGGCCGGCTGCAGCCTGGAG
AACATCACCGGTGAGCCCGCCCGCAGCGAACCGCTTCCCTTGCTTCTCCTGCCCCCCTCGGCAAAGTAAAGCGGC
AGAGGGAGATGGAGAAGAGACGTAGTCAGATAAGAATCAATCCGGACTCTGATTTCGCCGTCTTTCCGCCGAGCA
AAAAAGCCACCGCCCGCGTCGTGCTCGACGTCTGCAAAAACGAGGTCCCAGACTCGGTCCGCGTCTCGGCCCCCG
AGGCAACGGCCCCCGCCGCCGCCGTCTCCGCTGCCGCCGCCACGCTTTGGGCGCCTTGCCTAGGTGGCTTTGCTT
TCGCCGCTGCCGCCGCTGTCTTGCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail