Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10494
Gene name
LocationContig_855:84..938
Strand-
Gene length (bp)854
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.2E-15 101 196
PF00083 Sugar_tr Sugar (and other) transporter 5.6E-09 113 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 63 198 1.0E-20
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 75 198 4.0E-18
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 50 196 4.0E-16
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 67 196 8.0E-16
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 69 199 8.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 63 198 1.0E-20
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 75 198 4.0E-18
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 50 196 4.0E-16
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 67 196 8.0E-16
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 69 199 8.0E-15
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 69 199 8.0E-15
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 77 198 1.0E-14
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 74 198 2.0E-14
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 66 195 2.0E-14
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 16 199 6.0E-13
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 75 199 2.0E-12
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 76 199 2.0E-12
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 77 198 5.0E-12
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 75 195 7.0E-12
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 68 195 2.0E-10
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 75 199 2.0E-10
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 67 199 3.0E-10
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 76 199 1.0E-09
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 76 199 1.0E-08
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 77 195 2.0E-08
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 77 195 3.0E-08
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 75 192 4.0E-08
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 82 196 1.0E-07
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 3 191 2.0E-07
sp|Q8FDU9|NANT2_ECOL6 Putative sialic acid transporter 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT2 PE=3 SV=1 109 192 5.0E-07
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 109 192 6.0E-07
sp|E8ZB61|GALT_PSEPU Gallate transporter OS=Pseudomonas putida GN=galT PE=3 SV=1 76 192 7.0E-07
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 76 198 7.0E-07
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 109 192 9.0E-07
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 109 192 9.0E-07
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 109 192 9.0E-07
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 109 192 9.0E-07
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 109 192 9.0E-07
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 109 192 9.0E-07
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 109 192 1.0E-06
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 109 192 1.0E-06
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 76 199 1.0E-06
sp|A8AQB4|NANT_CITK8 Putative sialic acid transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanT PE=3 SV=1 109 192 1.0E-06
sp|B7LRJ2|NANT_ESCF3 Putative sialic acid transporter OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nanT PE=3 SV=1 109 192 2.0E-06
sp|Q8FD59|NANT1_ECOL6 Putative sialic acid transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT1 PE=3 SV=2 109 192 5.0E-06
sp|B1LGI9|NANT_ECOSM Putative sialic acid transporter OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B6I1U2|NANT_ECOSE Putative sialic acid transporter OS=Escherichia coli (strain SE11) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B7NKT5|NANT_ECO7I Putative sialic acid transporter OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B7UJV7|NANT_ECO27 Putative sialic acid transporter OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|A7ZSB7|NANT_ECO24 Putative sialic acid transporter OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B5YSV1|NANT_ECO5E Putative sialic acid transporter OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|Q8X9G8|NANT_ECO57 Putative sialic acid transporter OS=Escherichia coli O157:H7 GN=nanT PE=3 SV=2 109 192 5.0E-06
sp|Q0TCP2|NANT_ECOL5 Putative sialic acid transporter OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|P59699|NANT_SHIFL Putative sialic acid transporter OS=Shigella flexneri GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|Q0T066|NANT_SHIF8 Putative sialic acid transporter OS=Shigella flexneri serotype 5b (strain 8401) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B2U1W0|NANT_SHIB3 Putative sialic acid transporter OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B1IQQ5|NANT_ECOLC Putative sialic acid transporter OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B7M0T6|NANT_ECO8A Putative sialic acid transporter OS=Escherichia coli O8 (strain IAI1) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B7LHS8|NANT_ECO55 Putative sialic acid transporter OS=Escherichia coli (strain 55989 / EAEC) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|P41036|NANT_ECOLI Putative sialic acid transporter OS=Escherichia coli (strain K12) GN=nanT PE=1 SV=2 109 192 5.0E-06
sp|B1XHJ7|NANT_ECODH Putative sialic acid transporter OS=Escherichia coli (strain K12 / DH10B) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|C4ZSW2|NANT_ECOBW Putative sialic acid transporter OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|B7MBY6|NANT_ECO45 Putative sialic acid transporter OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 109 192 5.0E-06
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 71 200 8.0E-06
sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 106 192 9.0E-06
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 77 192 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22
2 129 151 22
3 164 186 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10494
MSRTNSSETVTGSTAQQAHAGGENSTPHYIHHLDARDASEGYGEEARVRSLGALDDGTSPGPRGQTELVAMAWAP
DDPDNPHNWTNRKKGLVLVVSAVLVINSTMSSSLPSMAVPEMTGEFGVRSAVQRVLPISVFLIGYVFGPLVWGPL
SEQLGRRRPTIATFAAFSLSTLACALAPSWPALLVFRFLCGIFASSPIAG*
Coding >Hirsu2|10494
ATGTCGCGGACCAACTCCAGCGAGACGGTGACGGGCTCGACGGCCCAGCAAGCGCACGCGGGAGGCGAGAACTCG
ACTCCGCACTACATCCACCACCTGGACGCTCGAGACGCCAGCGAAGGGTATGGCGAAGAGGCAAGGGTTCGCAGC
TTGGGCGCCCTCGACGACGGCACGAGCCCGGGACCTCGAGGCCAGACGGAGCTGGTGGCCATGGCATGGGCCCCA
GACGACCCCGACAACCCACACAACTGGACGAATCGCAAGAAGGGCCTCGTGCTCGTGGTGTCGGCCGTGCTGGTG
ATCAACTCGACGATGAGCTCGTCGCTGCCGAGCATGGCGGTGCCGGAGATGACGGGCGAGTTCGGCGTGCGGTCG
GCGGTGCAGCGGGTGCTGCCCATCTCCGTCTTCCTCATCGGCTACGTCTTCGGCCCGCTCGTCTGGGGCCCGCTG
AGCGAGCAGCTGGGCCGGCGGCGGCCGACCATCGCCACCTTCGCCGCCTTCTCGCTCTCGACGCTGGCCTGCGCG
CTGGCGCCCTCGTGGCCGGCCCTGCTCGTCTTTCGCTTCCTGTGCGGCATCTTCGCCAGCTCGCCCATCGCCGGG
TAG
Transcript >Hirsu2|10494
ATGTCGCGGACCAACTCCAGCGAGACGGTGACGGGCTCGACGGCCCAGCAAGCGCACGCGGGAGGCGAGAACTCG
ACTCCGCACTACATCCACCACCTGGACGCTCGAGACGCCAGCGAAGGGTATGGCGAAGAGGCAAGGGTTCGCAGC
TTGGGCGCCCTCGACGACGGCACGAGCCCGGGACCTCGAGGCCAGACGGAGCTGGTGGCCATGGCATGGGCCCCA
GACGACCCCGACAACCCACACAACTGGACGAATCGCAAGAAGGGCCTCGTGCTCGTGGTGTCGGCCGTGCTGGTG
ATCAACTCGACGATGAGCTCGTCGCTGCCGAGCATGGCGGTGCCGGAGATGACGGGCGAGTTCGGCGTGCGGTCG
GCGGTGCAGCGGGTGCTGCCCATCTCCGTCTTCCTCATCGGCTACGTCTTCGGCCCGCTCGTCTGGGGCCCGCTG
AGCGAGCAGCTGGGCCGGCGGCGGCCGACCATCGCCACCTTCGCCGCCTTCTCGCTCTCGACGCTGGCCTGCGCG
CTGGCGCCCTCGTGGCCGGCCCTGCTCGTCTTTCGCTTCCTGTGCGGCATCTTCGCCAGCTCGCCCATCGCCGGG
TAG
Gene >Hirsu2|10494
ATGTCGCGGACCAACTCCAGCGAGACGGTGACGGGCTCGACGGCCCAGCAAGCGCGTAAGCTCCCTTCGCCTCGT
CCTCGTCCTCGCATCCCAGTACACATATACATGCCCTTCCGTCGAGGAGGGGATCGTCGTGATTTAACCGGCTAT
GCAGACGCGGGAGGCGAGAACTCGACTCCGCACTACATCCACCACCTGGACGCTCGAGACGCCAGCGAAGGGTAT
GGCGAAGAGGCAAGGGTTCGCAGCTTGGGCGCCCTCGACGACGGCACGAGCCCGGGACCTCGAGGCCAGACGGAG
CTGGTGGCCATGGCATGGGCCCCAGACGACCCCGACAACCCACACAACTGGACGAATGTAAGCGCCCTCTTTCTC
TCTCTCGCGCGCGCGCGTTTCGTTCGTCCGGCCGGGAAGAAAAAAAAACCCACCCAATGGGCACCTCGGCGCTGA
CCGGGCGCGCAGCGCAAGAAGGGCCTCGTGCTCGTGGTGTCGGCCGTGCTGGTGATCAACTCGACGATGAGCTCG
TCGCTGCCGAGCATGGCGGTGCCGGAGATGACGGGCGAGTTCGGCGTGCGGTCGGCGGTGCAGCGGGTGCTGCCC
ATCTCCGTCTTCCTCATCGGCTACGTCTTCGGCCCGCTCGTCTGGGGCCCGCTGAGCGAGCAGCTGGGCCGGCGG
CGGCCGACCATCGCCACCTTCGCCGCCTTCTCGCTCTCGACGCTGGCCTGCGCGCTGGCGCCCTCGTGGCCGGCC
CTGCTCGTCTTTCGCTTCCTGTGCGGCATCTTCGCCAGCTCGCCCATCGCCGTCGTCGCCGGCATCCTGGCCGAC
ATCTACGGCGAGCCGCGCACAAGGGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail