Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10484
Gene name
LocationContig_853:88..897
Strand+
Gene length (bp)809
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 4.0E-09 8 61
PF13649 Methyltransf_25 Methyltransferase domain 5.9E-07 4 59

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA8|YL8A_SCHPO Uncharacterized methyltransferase-like C25B8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.10 PE=3 SV=1 8 171 7.0E-19
sp|Q9UTA9|YL89_SCHPO Uncharacterized methyltransferase C25B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.09 PE=3 SV=1 8 171 1.0E-18
sp|P65349|Y3374_MYCBO Uncharacterized methyltransferase Mb3374 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3374 PE=3 SV=1 10 69 2.0E-09
sp|P9WK01|Y3342_MYCTU Uncharacterized methyltransferase Rv3342 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3342 PE=1 SV=1 10 69 2.0E-09
sp|P9WK00|Y3342_MYCTO Uncharacterized methyltransferase MT3445 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3445 PE=3 SV=1 10 69 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA8|YL8A_SCHPO Uncharacterized methyltransferase-like C25B8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.10 PE=3 SV=1 8 171 7.0E-19
sp|Q9UTA9|YL89_SCHPO Uncharacterized methyltransferase C25B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.09 PE=3 SV=1 8 171 1.0E-18
sp|P65349|Y3374_MYCBO Uncharacterized methyltransferase Mb3374 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3374 PE=3 SV=1 10 69 2.0E-09
sp|P9WK01|Y3342_MYCTU Uncharacterized methyltransferase Rv3342 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3342 PE=1 SV=1 10 69 2.0E-09
sp|P9WK00|Y3342_MYCTO Uncharacterized methyltransferase MT3445 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3445 PE=3 SV=1 10 69 2.0E-09
sp|P30866|YAFE_ECOLI Uncharacterized protein YafE OS=Escherichia coli (strain K12) GN=yafE PE=3 SV=1 4 75 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10484
MRAALEAKRLPRVEVRDGLASSVPVVDGWADAVIAAQSFHWFADDEALEEMHRVLKPGGKLGMIWNIEDYNQPMK
WSPSTQWEGKLKQLVLELAPDGPPRFRDDKWWQVFERQSRADKPLFSTPIGQEKVAFEVWLSKERLWDRIDTLSQ
VATLQGASKEAFKARFEQILREGDGTWNEAGEIRFHGATVYAWTTRL*
Coding >Hirsu2|10484
ATGCGCGCTGCGCTTGAGGCTAAGCGGCTGCCGCGCGTCGAGGTCCGTGATGGGCTTGCGTCGAGCGTGCCTGTT
GTCGATGGCTGGGCGGATGCGGTCATCGCTGCGCAGTCGTTCCACTGGTTCGCGGACGACGAGGCGCTCGAGGAG
ATGCACCGGGTGCTGAAGCCCGGAGGCAAGCTGGGCATGATTTGGAATATCGAGGACTACAACCAGCCGATGAAG
TGGAGTCCGTCGACGCAGTGGGAGGGCAAGCTCAAGCAGCTGGTGCTCGAGCTCGCGCCCGACGGGCCGCCGCGC
TTCCGGGACGACAAATGGTGGCAAGTCTTCGAGCGGCAGTCGCGTGCCGACAAGCCGCTCTTCTCCACGCCCATC
GGCCAGGAAAAGGTGGCGTTCGAGGTCTGGCTCAGCAAGGAGAGGCTGTGGGACAGGATCGACACCCTCAGCCAG
GTGGCGACGCTGCAGGGCGCGAGCAAGGAGGCCTTCAAGGCTCGCTTTGAGCAGATCCTGCGCGAGGGAGACGGG
ACGTGGAACGAAGCAGGCGAGATCAGGTTTCATGGCGCGACCGTGTATGCGTGGACGACGAGGCTGTAG
Transcript >Hirsu2|10484
ATGCGCGCTGCGCTTGAGGCTAAGCGGCTGCCGCGCGTCGAGGTCCGTGATGGGCTTGCGTCGAGCGTGCCTGTT
GTCGATGGCTGGGCGGATGCGGTCATCGCTGCGCAGTCGTTCCACTGGTTCGCGGACGACGAGGCGCTCGAGGAG
ATGCACCGGGTGCTGAAGCCCGGAGGCAAGCTGGGCATGATTTGGAATATCGAGGACTACAACCAGCCGATGAAG
TGGAGTCCGTCGACGCAGTGGGAGGGCAAGCTCAAGCAGCTGGTGCTCGAGCTCGCGCCCGACGGGCCGCCGCGC
TTCCGGGACGACAAATGGTGGCAAGTCTTCGAGCGGCAGTCGCGTGCCGACAAGCCGCTCTTCTCCACGCCCATC
GGCCAGGAAAAGGTGGCGTTCGAGGTCTGGCTCAGCAAGGAGAGGCTGTGGGACAGGATCGACACCCTCAGCCAG
GTGGCGACGCTGCAGGGCGCGAGCAAGGAGGCCTTCAAGGCTCGCTTTGAGCAGATCCTGCGCGAGGGAGACGGG
ACGTGGAACGAAGCAGGCGAGATCAGGTTTCATGGCGCGACCGTGTATGCGTGGACGACGAGGCTGTAG
Gene >Hirsu2|10484
ATGCGCGCTGCGCTTGAGGCTAAGCGGCTGCCGCGCGTCGAGGTCCGTGATGGGCTTGCGTCGAGCGTGCCTGTT
GTCGATGGCTGGGCGGATGCGGTCATCGCTGCGCAGGTCTGGGAACCCCCCTCCGTTCTTGTTTTTTCTTCGGCT
TGCTAGCCCCGATCGAAGTCTGTTGGCTGAACGGGTCCGGGTTCGTCGCGGCAGTCGTTCCACTGGTGGGTTTCC
GTCGCTACGCATCGGTCACGAGGCGAGCTCACGGCCGGCAGGTTCGCGGACGACGAGGCGCTCGAGGAGATGCAC
CGGGTGCTGAAGCCCGGAGGCAAGCTGGGCATGATTTGGAATATCGAGGACTGTGGGCTACGCTCTCCCTCCCCA
TCCCCCTTGTCCCGACCGCCGCCCCCCCGGCTCACGCCCGTCCATCAGACAACCAGCCGATGAAGTGGAGTCCGT
CGACGCAGTGGGAGGGCAAGCTCAAGCAGCTGGTGCTCGAGCTCGCGCCCGACGGGCCGCCGCGCTTCCGGGACG
ACAAATGGTGGCAAGTCTTCGAGCGGCAGTCGCGTGCCGACAAGCCGCTCTTCTCCACGCCCATCGGCCAGGAAA
AGGTGGCGTTCGAGGTCTGGCTCAGCAAGGAGAGGCTGTGGGACAGGATCGACACCCTCAGCCAGGTGGCGACGC
TGCAGGGCGCGAGCAAGGAGGCCTTCAAGGCTCGCTTTGAGCAGATCCTGCGCGAGGGAGACGGGACGTGGAACG
AAGCAGGCGAGATCAGGTTTCATGGCGCGACCGTGTATGCGTGGACGACGAGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail