Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10471
Gene name
LocationContig_85:22936..25436
Strand+
Gene length (bp)2500
Transcript length (bp)2205
Coding sequence length (bp)2205
Protein length (aa) 735

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.0E-15 359 501
PF01426 BAH BAH domain 1.1E-10 92 210
PF13191 AAA_16 AAA ATPase domain 6.3E-09 333 472
PF17872 AAA_lid_10 AAA lid domain 3.1E-10 532 566
PF13401 AAA_22 AAA domain 1.2E-07 355 466

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54789|ORC1_SCHPO Origin recognition complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc1 PE=1 SV=1 92 731 1.0E-153
sp|Q6BSE2|ORC1_DEBHA Origin recognition complex subunit 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ORC1 PE=3 SV=2 311 730 2.0E-115
sp|O74270|ORC1_CANAX Origin recognition complex subunit 1 OS=Candida albicans GN=ORC1 PE=2 SV=1 310 724 1.0E-98
sp|O16810|ORC1_DROME Origin recognition complex subunit 1 OS=Drosophila melanogaster GN=Orc1 PE=1 SV=2 307 725 3.0E-87
sp|Q13415|ORC1_HUMAN Origin recognition complex subunit 1 OS=Homo sapiens GN=ORC1 PE=1 SV=2 249 724 2.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54789|ORC1_SCHPO Origin recognition complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc1 PE=1 SV=1 92 731 1.0E-153
sp|Q6BSE2|ORC1_DEBHA Origin recognition complex subunit 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ORC1 PE=3 SV=2 311 730 2.0E-115
sp|O74270|ORC1_CANAX Origin recognition complex subunit 1 OS=Candida albicans GN=ORC1 PE=2 SV=1 310 724 1.0E-98
sp|O16810|ORC1_DROME Origin recognition complex subunit 1 OS=Drosophila melanogaster GN=Orc1 PE=1 SV=2 307 725 3.0E-87
sp|Q13415|ORC1_HUMAN Origin recognition complex subunit 1 OS=Homo sapiens GN=ORC1 PE=1 SV=2 249 724 2.0E-84
sp|Q58DC8|ORC1_BOVIN Origin recognition complex subunit 1 OS=Bos taurus GN=ORC1 PE=2 SV=2 218 724 2.0E-84
sp|Q9JI69|ORC1_CRIGR Origin recognition complex subunit 1 OS=Cricetulus griseus GN=ORC1 PE=2 SV=1 314 724 5.0E-83
sp|Q80Z32|ORC1_RAT Origin recognition complex subunit 1 OS=Rattus norvegicus GN=Orc1 PE=2 SV=1 241 724 1.0E-82
sp|Q9Z1N2|ORC1_MOUSE Origin recognition complex subunit 1 OS=Mus musculus GN=Orc1 PE=1 SV=2 314 724 1.0E-82
sp|P54788|ORC1_KLULA Origin recognition complex subunit 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ORC1 PE=3 SV=2 333 730 3.0E-78
sp|Q710E8|ORC1A_ARATH Origin of replication complex subunit 1A OS=Arabidopsis thaliana GN=ORC1A PE=1 SV=1 313 727 3.0E-76
sp|P54784|ORC1_YEAST Origin recognition complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORC1 PE=1 SV=1 266 730 9.0E-75
sp|Q9SU24|ORC1B_ARATH Origin of replication complex subunit 1B OS=Arabidopsis thaliana GN=ORC1B PE=1 SV=1 306 727 5.0E-72
sp|Q5SMU7|ORC1_ORYSJ Origin of replication complex subunit 1 OS=Oryza sativa subsp. japonica GN=ORC1 PE=2 SV=1 313 636 7.0E-62
sp|Q54RM2|ORC1_DICDI Origin recognition complex subunit 1 OS=Dictyostelium discoideum GN=orcA PE=3 SV=1 320 637 3.0E-59
sp|Q8I615|ORC1_PLAF7 Origin recognition complex subunit 1 OS=Plasmodium falciparum (isolate 3D7) GN=orc1 PE=2 SV=1 324 627 2.0E-52
sp|O89033|CDC6_MOUSE Cell division control protein 6 homolog OS=Mus musculus GN=Cdc6 PE=1 SV=2 317 721 3.0E-48
sp|Q99741|CDC6_HUMAN Cell division control protein 6 homolog OS=Homo sapiens GN=CDC6 PE=1 SV=1 317 723 2.0E-47
sp|Q5N897|CDC6_ORYSJ Cell division control protein 6 homolog OS=Oryza sativa subsp. japonica GN=CDC6 PE=2 SV=1 317 638 6.0E-42
sp|Q8W032|CDC6B_ARATH Cell division control protein 6 homolog B OS=Arabidopsis thaliana GN=CDC6B PE=2 SV=1 306 621 2.0E-36
sp|O82387|CDC6A_ARATH Cell division control protein 6 homolog OS=Arabidopsis thaliana GN=CDC6 PE=2 SV=2 262 723 2.0E-29
sp|P41411|CDC18_SCHPO Cell division control protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc18 PE=1 SV=1 336 624 3.0E-27
sp|P09119|CDC6_YEAST Cell division control protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC6 PE=1 SV=3 260 655 3.0E-22
sp|O29995|CDC61_ARCFU ORC1-type DNA replication protein 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cdc6-1 PE=3 SV=1 321 624 5.0E-20
sp|Q975X3|CDC61_SULTO ORC1-type DNA replication protein 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cdc6-1 PE=3 SV=1 329 641 7.0E-18
sp|B8D6H2|CDC6_DESK1 ORC1-type DNA replication protein OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=cdc6 PE=3 SV=1 321 623 1.0E-16
sp|Q2FN79|CDC6_METHJ ORC1-type DNA replication protein OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=cdc6 PE=3 SV=1 321 630 1.0E-15
sp|Q4JAS8|CDC61_SULAC ORC1-type DNA replication protein 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cdc6-1 PE=3 SV=1 318 624 2.0E-15
sp|A2SPC3|CDC6_METLZ ORC1-type DNA replication protein OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=cdc6 PE=3 SV=1 300 624 3.0E-15
sp|Q980N4|CDC61_SULSO ORC1-type DNA replication protein 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cdc6-1 PE=1 SV=1 310 565 5.0E-15
sp|O57864|CDC6_PYRHO ORC1-type DNA replication protein OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cdc6 PE=3 SV=2 327 624 7.0E-15
sp|Q6KZL0|CDC6_PICTO ORC1-type DNA replication protein OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=cdc6 PE=3 SV=1 324 624 1.0E-14
sp|Q8PXA8|CDC61_METMA ORC1-type DNA replication protein 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=cdc6-1 PE=3 SV=1 327 649 1.0E-14
sp|Q8TUR2|CDC61_METAC ORC1-type DNA replication protein 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=cdc6-1 PE=3 SV=2 327 649 4.0E-14
sp|Q9YEV6|CDC61_AERPE ORC1-type DNA replication protein 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=orc1 PE=1 SV=3 329 624 5.0E-14
sp|P81413|CDC6_PYRFU ORC1-type DNA replication protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cdc6 PE=1 SV=1 327 624 9.0E-14
sp|Q9V2F2|CDC6_PYRAB ORC1-type DNA replication protein OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cdc6 PE=1 SV=2 294 624 2.0E-13
sp|Q9HMS3|CDC67_HALSA ORC1-type DNA replication protein 7 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=orc7 PE=3 SV=1 444 639 1.0E-12
sp|Q5JET2|CDC6_THEKO ORC1-type DNA replication protein OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cdc6 PE=3 SV=1 327 624 3.0E-12
sp|A0RYN2|CDC6_CENSY ORC1-type DNA replication protein OS=Cenarchaeum symbiosum (strain A) GN=cdc6 PE=3 SV=1 321 663 8.0E-12
sp|A7I464|CDC6_METB6 ORC1-type DNA replication protein OS=Methanoregula boonei (strain 6A8) GN=cdc6 PE=3 SV=1 321 623 1.0E-11
sp|A3CRD6|CDC6_METMJ ORC1-type DNA replication protein OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=cdc6 PE=3 SV=1 330 624 2.0E-11
sp|B6YUE9|CDC6_THEON ORC1-type DNA replication protein OS=Thermococcus onnurineus (strain NA1) GN=cdc6 PE=3 SV=1 327 624 4.0E-11
sp|Q97AP1|CDC6_THEVO ORC1-type DNA replication protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=cdc6 PE=3 SV=2 313 624 5.0E-10
sp|Q5V6G0|CDC6K_HALMA ORC1-type DNA replication protein 11 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cdc6k PE=3 SV=1 313 564 6.0E-10
sp|Q5UWY4|CDC6B_HALMA ORC1-type DNA replication protein 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cdc6b PE=3 SV=1 321 564 6.0E-10
sp|Q2NIC5|CDC6_METST ORC1-type DNA replication protein OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=cdc6 PE=3 SV=1 329 607 1.0E-08
sp|P29569|CDC6V_METTF ORC1-type DNA replication protein OS=Methanothermobacter thermautotrophicus GN=cdc6 PE=3 SV=1 329 602 1.0E-08
sp|P29570|CDC6Z_METTF ORC1-type DNA replication protein OS=Methanothermobacter thermautotrophicus GN=cdc6 PE=3 SV=1 329 602 1.0E-08
sp|Q9HKG3|CDC62_THEAC ORC1-type DNA replication protein 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=cdc6-2 PE=1 SV=1 317 621 1.0E-08
sp|Q5V7B0|CDC6M_HALMA ORC1-type DNA replication protein 13 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cdc6m PE=3 SV=1 324 622 5.0E-08
sp|Q5V1W6|CDC6G_HALMA ORC1-type DNA replication protein 7 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cdc6g PE=3 SV=1 330 567 2.0E-07
sp|O29563|CDC62_ARCFU ORC1-type DNA replication protein 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cdc6-2 PE=3 SV=1 329 638 3.0E-07
sp|Q5V7I2|CDC6O_HALMA ORC1-type DNA replication protein 15 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cdc6o PE=3 SV=1 357 566 7.0E-07
sp|Q9UXF8|CDC62_SULSO ORC1-type DNA replication protein 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cdc6-2 PE=1 SV=1 329 642 1.0E-06
sp|Q9HSW6|CDC6A_HALSA ORC1-type DNA replication protein 10 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=orc10 PE=3 SV=2 330 602 7.0E-06
sp|Q9HQC7|CDC68_HALSA ORC1-type DNA replication protein 8 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=orc8 PE=3 SV=1 359 602 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003682 chromatin binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10471
MAPRSHTRRGAEPPSSRYKQASSFGGGGGDSGDELASDDQPWEWIYNVEEPVHGDGGGGGGGGGQSDRKRRKVSG
TKIVGARMGRPGGFECRVGDCVLLKAEGSNEAWVAMICEFVEDDGEGEKAANFMWFSTEKEIRNKNKKRTDFYSN
ELYISPSWDVNPLASIDGRAKVMSHGAFLEKYPSGRVPRQSADSGKTFVCRRGCNTRTATYTDEFDWDEVYRGGD
DIFDLIERVERDTKATRARRKPRSQSPQETAYEPPQTPTKAAAPRPAATPQSRGGRAEPGSRSHRKGTGKRLEFT
PLATRKLSPSDVQSSPFQIARSRLHVSSVPSSLPCREGEFSLVYSHLEAAIGEGTGNCIYISGTPGTGKTATVRE
VIARLEEAVGSDELDDFIFVEINGMKITDPHQSYTLLWDALKGQRASPSQALDLLEREFGNPSPRRIPCVVLMDE
LDQLVTKNQAVMYNFFNWPTLRHSRLIVLAVANTMDLPERTLSNKISSRLGLTRITFPGYTHDQLMKIIQSRLEG
VPGDIVDPDAVQFASRKVAAVSGDARRALDICRRAVELAESTVQGDPSTPSKSGSSSRRGRVTIATIKKAINEAT
TNPVQQHLRGLPLMAKLFMAALLLRIRRTGLAETTFGETLDELQRATAHSAPKTPGIALMLGDGSKRTSAAGHRP
FSRPSHVHTAAMDLVAAGLVNLEAQRAERSSKLRLAIADDEVKMALRDDEELKAMGIGI*
Coding >Hirsu2|10471
ATGGCGCCGCGCAGCCACACAAGACGTGGCGCGGAGCCGCCGAGCAGCCGCTACAAGCAGGCTTCTTCGTTCGGC
GGCGGCGGCGGCGACTCCGGCGACGAGCTGGCAAGCGACGACCAGCCCTGGGAATGGATCTACAACGTTGAGGAG
CCGGTACACGGCGATGGCGGCGGCGGCGGCGGCGGCGGCGGCCAGAGCGACCGGAAGAGGAGAAAGGTGTCCGGT
ACCAAGATCGTGGGCGCCCGCATGGGCCGGCCGGGGGGCTTCGAGTGCCGCGTCGGCGACTGCGTCCTGCTCAAG
GCCGAGGGTTCCAACGAGGCCTGGGTGGCAATGATCTGCGAGTTTGTCGAGGACGACGGCGAGGGCGAAAAGGCC
GCAAACTTCATGTGGTTCTCGACCGAGAAGGAGATCCGCAACAAGAACAAGAAGCGCACCGACTTCTACTCGAAT
GAGCTGTACATTAGCCCGTCGTGGGACGTCAACCCGCTGGCCTCGATCGACGGCCGGGCCAAGGTCATGTCGCAC
GGCGCCTTTCTCGAGAAGTACCCGTCCGGGCGGGTGCCGCGGCAGAGCGCCGACTCTGGTAAGACCTTCGTCTGC
CGGCGCGGCTGCAACACCCGGACGGCGACGTACACGGACGAGTTCGACTGGGACGAGGTCTACCGTGGCGGCGAC
GACATCTTCGACCTGATCGAGCGCGTCGAGAGAGACACCAAGGCGACGCGCGCACGCCGCAAACCGCGGAGCCAG
TCGCCGCAGGAGACAGCCTACGAGCCGCCCCAGACGCCAACCAAGGCGGCGGCGCCCAGGCCGGCCGCGACGCCG
CAGTCGAGAGGCGGCCGTGCCGAGCCGGGCTCGCGGAGCCACAGAAAGGGCACGGGGAAGAGGCTCGAGTTCACG
CCGCTGGCGACCCGCAAGCTCTCGCCGAGCGATGTCCAGTCGTCGCCGTTTCAGATAGCGCGGTCCCGCCTCCAC
GTCTCGTCCGTGCCGTCGTCGCTCCCCTGCCGCGAGGGCGAGTTCTCCCTCGTCTACTCCCACCTCGAGGCCGCC
ATCGGCGAGGGCACCGGCAACTGCATCTACATCTCCGGCACGCCGGGCACGGGCAAGACGGCCACCGTGCGCGAG
GTCATCGCCCGGCTCGAGGAGGCCGTCGGCTCGGACGAGCTGGACGACTTCATCTTCGTCGAGATCAACGGCATG
AAAATCACGGATCCCCACCAGTCCTACACCCTGCTGTGGGATGCCCTCAAGGGCCAGCGGGCTAGTCCGTCGCAG
GCGCTGGATCTCCTGGAGAGGGAGTTCGGCAACCCGAGCCCGCGCCGCATCCCCTGCGTCGTCCTGATGGACGAG
CTGGACCAACTCGTCACCAAGAATCAGGCGGTCATGTACAATTTTTTTAACTGGCCGACGTTGCGGCACAGCCGC
CTCATCGTCCTCGCCGTTGCCAACACCATGGACCTCCCTGAGCGGACGCTGAGTAACAAGATCAGTAGCCGACTA
GGCCTCACGCGCATCACATTTCCCGGCTACACACATGATCAACTCATGAAAATCATACAGTCGCGTCTTGAAGGC
GTGCCTGGCGACATAGTCGATCCGGATGCCGTGCAGTTTGCCAGTCGAAAGGTTGCGGCCGTCAGCGGCGACGCT
CGAAGAGCCCTCGACATCTGCCGCCGCGCCGTCGAGCTGGCCGAGAGTACCGTCCAGGGCGATCCTTCGACGCCG
AGCAAATCTGGAAGCTCGTCGCGCCGAGGGCGGGTGACCATCGCCACCATCAAAAAGGCCATCAACGAGGCAACT
ACCAATCCCGTTCAGCAACACCTCCGCGGCCTCCCGCTCATGGCCAAGCTCTTCATGGCAGCGCTTCTCCTCAGA
ATCCGGAGGACCGGCCTCGCGGAGACCACTTTTGGCGAGACTCTCGACGAGCTACAACGGGCCACGGCCCATTCC
GCGCCGAAAACACCCGGTATTGCCCTCATGCTCGGCGACGGCTCGAAGAGGACCTCGGCAGCCGGCCATCGGCCC
TTCAGCCGGCCCAGCCACGTTCACACGGCGGCTATGGACCTGGTCGCCGCGGGACTCGTCAACTTGGAGGCGCAG
CGCGCCGAAAGGTCCAGTAAGCTGCGGCTCGCGATAGCCGATGACGAAGTGAAGATGGCTCTCCGCGACGACGAG
GAGCTCAAAGCCATGGGCATTGGAATATGA
Transcript >Hirsu2|10471
ATGGCGCCGCGCAGCCACACAAGACGTGGCGCGGAGCCGCCGAGCAGCCGCTACAAGCAGGCTTCTTCGTTCGGC
GGCGGCGGCGGCGACTCCGGCGACGAGCTGGCAAGCGACGACCAGCCCTGGGAATGGATCTACAACGTTGAGGAG
CCGGTACACGGCGATGGCGGCGGCGGCGGCGGCGGCGGCGGCCAGAGCGACCGGAAGAGGAGAAAGGTGTCCGGT
ACCAAGATCGTGGGCGCCCGCATGGGCCGGCCGGGGGGCTTCGAGTGCCGCGTCGGCGACTGCGTCCTGCTCAAG
GCCGAGGGTTCCAACGAGGCCTGGGTGGCAATGATCTGCGAGTTTGTCGAGGACGACGGCGAGGGCGAAAAGGCC
GCAAACTTCATGTGGTTCTCGACCGAGAAGGAGATCCGCAACAAGAACAAGAAGCGCACCGACTTCTACTCGAAT
GAGCTGTACATTAGCCCGTCGTGGGACGTCAACCCGCTGGCCTCGATCGACGGCCGGGCCAAGGTCATGTCGCAC
GGCGCCTTTCTCGAGAAGTACCCGTCCGGGCGGGTGCCGCGGCAGAGCGCCGACTCTGGTAAGACCTTCGTCTGC
CGGCGCGGCTGCAACACCCGGACGGCGACGTACACGGACGAGTTCGACTGGGACGAGGTCTACCGTGGCGGCGAC
GACATCTTCGACCTGATCGAGCGCGTCGAGAGAGACACCAAGGCGACGCGCGCACGCCGCAAACCGCGGAGCCAG
TCGCCGCAGGAGACAGCCTACGAGCCGCCCCAGACGCCAACCAAGGCGGCGGCGCCCAGGCCGGCCGCGACGCCG
CAGTCGAGAGGCGGCCGTGCCGAGCCGGGCTCGCGGAGCCACAGAAAGGGCACGGGGAAGAGGCTCGAGTTCACG
CCGCTGGCGACCCGCAAGCTCTCGCCGAGCGATGTCCAGTCGTCGCCGTTTCAGATAGCGCGGTCCCGCCTCCAC
GTCTCGTCCGTGCCGTCGTCGCTCCCCTGCCGCGAGGGCGAGTTCTCCCTCGTCTACTCCCACCTCGAGGCCGCC
ATCGGCGAGGGCACCGGCAACTGCATCTACATCTCCGGCACGCCGGGCACGGGCAAGACGGCCACCGTGCGCGAG
GTCATCGCCCGGCTCGAGGAGGCCGTCGGCTCGGACGAGCTGGACGACTTCATCTTCGTCGAGATCAACGGCATG
AAAATCACGGATCCCCACCAGTCCTACACCCTGCTGTGGGATGCCCTCAAGGGCCAGCGGGCTAGTCCGTCGCAG
GCGCTGGATCTCCTGGAGAGGGAGTTCGGCAACCCGAGCCCGCGCCGCATCCCCTGCGTCGTCCTGATGGACGAG
CTGGACCAACTCGTCACCAAGAATCAGGCGGTCATGTACAATTTTTTTAACTGGCCGACGTTGCGGCACAGCCGC
CTCATCGTCCTCGCCGTTGCCAACACCATGGACCTCCCTGAGCGGACGCTGAGTAACAAGATCAGTAGCCGACTA
GGCCTCACGCGCATCACATTTCCCGGCTACACACATGATCAACTCATGAAAATCATACAGTCGCGTCTTGAAGGC
GTGCCTGGCGACATAGTCGATCCGGATGCCGTGCAGTTTGCCAGTCGAAAGGTTGCGGCCGTCAGCGGCGACGCT
CGAAGAGCCCTCGACATCTGCCGCCGCGCCGTCGAGCTGGCCGAGAGTACCGTCCAGGGCGATCCTTCGACGCCG
AGCAAATCTGGAAGCTCGTCGCGCCGAGGGCGGGTGACCATCGCCACCATCAAAAAGGCCATCAACGAGGCAACT
ACCAATCCCGTTCAGCAACACCTCCGCGGCCTCCCGCTCATGGCCAAGCTCTTCATGGCAGCGCTTCTCCTCAGA
ATCCGGAGGACCGGCCTCGCGGAGACCACTTTTGGCGAGACTCTCGACGAGCTACAACGGGCCACGGCCCATTCC
GCGCCGAAAACACCCGGTATTGCCCTCATGCTCGGCGACGGCTCGAAGAGGACCTCGGCAGCCGGCCATCGGCCC
TTCAGCCGGCCCAGCCACGTTCACACGGCGGCTATGGACCTGGTCGCCGCGGGACTCGTCAACTTGGAGGCGCAG
CGCGCCGAAAGGTCCAGTAAGCTGCGGCTCGCGATAGCCGATGACGAAGTGAAGATGGCTCTCCGCGACGACGAG
GAGCTCAAAGCCATGGGCATTGGAATATGA
Gene >Hirsu2|10471
ATGGCGCCGCGCAGCCACACAAGACGTGGCGCGGAGCCGCCGAGCAGCCGCTACAAGCAGGCTTCTTCGTTCGGC
GGCGGCGGCGGCGACTCCGGCGACGAGCTGGCAAGCGACGACCAGCCCTGGGAATGGATCTACAACGTTGAGGAG
CCGGTACACGGCGATGGCGGCGGCGGCGGCGGCGGCGGCGGCCAGAGCGACCGGAAGAGGAGAAAGGTGTCCGGT
ACCAAGATCGTGGGCGCCCGCATGGGCCGGCCGGGGGGCTTCGAGTGCCGCGTCGGCGACTGCGTCCTGCTCAAG
GCCGAGGGTTCCAACGAGGCCTGGGTGGCAATGATCTGCGAGTTTGTCGAGGACGACGGCGAGGGCGAAAAGGCC
GCAAACTTCATGTGGTTCTCGACCGAGAAGGAGATCCGCAACAAGAACAAGAAGCGCACCGACTTCTACTCGGTA
TGCCCCCCCCCCCCCTATTATGCGCGCGCACGGCTCGGCGAACATCCGTGGCCCCGACATTCATATTCGAGGGAT
GCTTTTGCTTACCAGGAGGGGGGGCGGCGCGCCAGAATGAGCTGTACATTAGCCCGTCGTGGGACGTCAACCCGC
TGGCCTCGATCGACGGCCGGGCCAAGGTCATGTCGCACGGCGCCTTTCTCGAGAAGTACCCGTCCGGGCGGGTGC
CGCGGCAGAGCGCCGACTCTGGTAAGACCTTCGTCTGCCGGCGCGGCTGCAACACCCGGACGGCGACGTACACGG
ACGAGTTCGACTGGGACGAGGTCTACCGTGGCGGCGACGACATCTTCGACCTGATCGAGCGCGTCGAGAGAGACA
CCAAGGCGACGCGCGCACGCCGCAAACCGCGGAGCCAGTCGCCGCAGGAGACAGCCTACGAGCCGCCCCAGACGC
CAACCAAGGCGGCGGCGCCCAGGCCGGCCGCGACGCCGCAGTCGAGAGGCGGCCGTGCCGAGCCGGGCTCGCGGA
GCCACAGAAAGTAGGCGGCACAGCAGTCCGTCCATCCAAAACGAGGCGCTTGCATGCTGACCGGCCACGCGACAG
GGGCACGGGGAAGAGGCTCGAGTTCACGCCGCTGGCGACCCGCAAGCTCTCGCCGAGCGATGTCCAGTCGTCGCC
GTTTCAGATAGCGCGGTCCCGCCTCCACGTCTCGTCCGTGCCGTCGTCGCTCCCCTGCCGCGAGGGCGAGTTCTC
CCTCGTCTACTCCCACCTCGAGGCCGCCATCGGCGAGGGCACCGGCAACTGCATCTACATCTCCGGCACGCCGGG
CACGGGCAAGACGGCCACCGTGCGCGAGGTCATCGCCCGGCTCGAGGAGGCCGTCGGCTCGGACGAGCTGGACGA
CTTCATCTTCGTCGAGATCAACGGCATGAAAATCACGGATCCCCACCAGTCCTACACCCTGCTGTGGGATGCCCT
CAAGGGCCAGCGGGCTAGTCCGTCGCAGGCGCTGGATCTCCTGGAGAGGGAGTTCGGCAACCCGAGCCCGCGCCG
CATCCCCTGCGTCGTCCTGATGGACGAGCTGGACCAACTCGTCACCAAGAATCAGGCGGTCATGTACAATTTTTT
TAACTGGCCGACGTTGCGGCACAGCCGCCTCATCGTCCTCGCCGTTGCCAACACCATGGACCTCCCTGAGCGGAC
GCTGAGTAACAAGATCAGTAGCCGACTAGGTATGTCCGTCCAACTTGCAGTCCTCGGACGGCGACGCCCTGGATG
CGTGCGTCGTGGTCGAGCTAAATAACACGTGAGGAGCCCCTGACTGACGACGCCTCGCCATGCCCCTCTAGGCCT
CACGCGCATCACATTTCCCGGCTACACACATGATCAACTCATGAAAATCATACAGTCGCGTCTTGAAGGCGTGCC
TGGCGACATAGTCGATCCGGATGCCGTGCAGTTTGCCAGTCGAAAGGTTGCGGCCGTCAGCGGCGACGCTCGAAG
AGCCCTCGACATCTGCCGCCGCGCCGTCGAGCTGGCCGAGAGTACCGTCCAGGGCGATCCTTCGACGCCGAGCAA
ATCTGGAAGCTCGTCGCGCCGAGGGCGGGTGACCATCGCCACCATCAAAAAGGCCATCAACGAGGCAACTACCAA
TCCCGTTCAGCAACACCTCCGCGGCCTCCCGCTCATGGCCAAGCTCTTCATGGCAGCGCTTCTCCTCAGAATCCG
GAGGACCGGCCTCGCGGAGACCACTTTTGGCGAGACTCTCGACGAGCTACAACGGGCCACGGCCCATTCCGCGCC
GAAAACACCCGGTATTGCCCTCATGCTCGGCGACGGCTCGAAGAGGACCTCGGCAGCCGGCCATCGGCCCTTCAG
CCGGCCCAGCCACGTTCACACGGCGGCTATGGACCTGGTCGCCGCGGGACTCGTCAACTTGGAGGCGCAGCGCGC
CGAAAGGTCCAGTAAGCTGCGGCTCGCGATAGCCGATGACGAAGTGAAGATGGCTCTCCGCGACGACGAGGAGCT
CAAAGCCATGGGCATTGGAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail