Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1047
Gene name
LocationContig_1216:5177..6571
Strand+
Gene length (bp)1394
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 1.9E-07 102 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RM13|GMT_MAGO7 GDP-mannose transporter OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VRG4 PE=3 SV=1 1 377 2.0E-165
sp|Q5AQY2|GMT2_EMENI GDP-mannose transporter 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gmt2 PE=3 SV=2 37 371 5.0E-162
sp|Q2HA88|GMT_CHAGB GDP-mannose transporter OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VRG4 PE=3 SV=2 1 381 1.0E-161
sp|Q7SBC5|GMT_NEUCR GDP-mannose transporter OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vrg-4 PE=3 SV=1 1 388 3.0E-161
sp|A1DA52|GMT2_NEOFI GDP-mannose transporter 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=gmt2 PE=3 SV=1 34 371 1.0E-160
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RM13|GMT_MAGO7 GDP-mannose transporter OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VRG4 PE=3 SV=1 1 377 2.0E-165
sp|Q5AQY2|GMT2_EMENI GDP-mannose transporter 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gmt2 PE=3 SV=2 37 371 5.0E-162
sp|Q2HA88|GMT_CHAGB GDP-mannose transporter OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VRG4 PE=3 SV=2 1 381 1.0E-161
sp|Q7SBC5|GMT_NEUCR GDP-mannose transporter OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vrg-4 PE=3 SV=1 1 388 3.0E-161
sp|A1DA52|GMT2_NEOFI GDP-mannose transporter 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=gmt2 PE=3 SV=1 34 371 1.0E-160
sp|A7E558|GMT_SCLS1 GDP-mannose transporter OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=vrg4 PE=3 SV=1 1 370 3.0E-156
sp|A6RJQ8|GMT_BOTFB GDP-mannose transporter OS=Botryotinia fuckeliana (strain B05.10) GN=gmt1 PE=3 SV=1 1 370 4.0E-154
sp|Q0UG89|GMT_PHANO GDP-mannose transporter OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VRG4 PE=3 SV=1 3 370 4.0E-137
sp|A1C9R4|GMT_ASPCL GDP-mannose transporter OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=gmt1 PE=3 SV=1 3 370 7.0E-134
sp|Q2UTL1|GMT_ASPOR GDP-mannose transporter OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gmt1 PE=3 SV=2 4 370 2.0E-132
sp|Q0CA27|GMT_ASPTN GDP-mannose transporter OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=gmt1 PE=3 SV=1 1 370 2.0E-131
sp|A1CZJ3|GMT1_NEOFI GDP-mannose transporter 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=gmt1 PE=3 SV=1 3 371 5.0E-131
sp|Q1DTI4|GMT_COCIM GDP-mannose transporter OS=Coccidioides immitis (strain RS) GN=VRG4 PE=3 SV=2 61 370 5.0E-130
sp|Q4WTQ6|GMT_ASPFU GDP-mannose transporter OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gmt1 PE=3 SV=1 3 371 6.0E-130
sp|B0Y384|GMT_ASPFC GDP-mannose transporter OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gmt1 PE=3 SV=1 3 371 6.0E-130
sp|A2R9P4|GMT_ASPNC GDP-mannose transporter OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=gmt1 PE=3 SV=1 61 370 5.0E-129
sp|Q5AS82|GMT1_EMENI GDP-mannose transporter 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gmt1 PE=3 SV=2 3 370 7.0E-127
sp|Q9UTK8|GMT_SCHPO GDP-mannose transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vrg4 PE=3 SV=1 50 388 7.0E-119
sp|Q6C0U0|GMT_YARLI GDP-mannose transporter OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VRG4 PE=3 SV=1 52 376 3.0E-118
sp|Q4PFQ1|GMT_USTMA GDP-mannose transporter OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VRG4 PE=3 SV=1 12 382 4.0E-115
sp|P0CS04|GMT2_CRYNJ GDP-mannose transporter 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GMT2 PE=2 SV=1 29 385 1.0E-111
sp|P0CS05|GMT2_CRYNB GDP-mannose transporter 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GMT2 PE=3 SV=1 29 385 1.0E-111
sp|B0DI84|GMT_LACBS GDP-mannose transporter OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=VRG4 PE=3 SV=1 61 370 8.0E-111
sp|P0CS02|GMT1_CRYNJ GDP-mannose transporter 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GMT1 PE=2 SV=1 61 385 5.0E-110
sp|P0CS03|GMT1_CRYNB GDP-mannose transporter 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GMT1 PE=3 SV=1 61 385 5.0E-110
sp|A3LWX1|GMT_PICST GDP-mannose transporter OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VRG4 PE=3 SV=1 50 370 6.0E-108
sp|A8N9T6|GMT_COPC7 GDP-mannose transporter OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=VRG4 PE=3 SV=2 77 379 4.0E-106
sp|Q5A477|GMT_CANAL GDP-mannose transporter OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VRG4 PE=3 SV=1 51 363 2.0E-105
sp|Q2AAF6|GMT_PICPA GDP-mannose transporter OS=Komagataella pastoris GN=VIG4 PE=3 SV=1 52 376 5.0E-104
sp|A5DIN8|GMT_PICGU GDP-mannose transporter OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=VRG4 PE=3 SV=1 51 370 1.0E-103
sp|P40107|GMT1_YEAST GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VRG4 PE=1 SV=1 51 370 6.0E-103
sp|C8Z830|GMT1_YEAS8 GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=VRG4 PE=3 SV=1 51 370 6.0E-103
sp|A6ZTW6|GMT1_YEAS7 GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=VRG4 PE=3 SV=1 51 370 6.0E-103
sp|C7GUZ7|GMT1_YEAS2 GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain JAY291) GN=VRG4 PE=3 SV=1 51 370 6.0E-103
sp|B3LHR7|GMT1_YEAS1 GDP-mannose transporter 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=VRG4 PE=3 SV=1 51 370 6.0E-103
sp|A7TR80|GMT1_VANPO GDP-mannose transporter 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=VRG4-1 PE=3 SV=1 40 370 1.0E-100
sp|C8Z742|GMT2_YEAS8 Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HVG1 PE=3 SV=1 42 363 3.0E-98
sp|Q6CYD0|GMT_KLULA GDP-mannose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VRG4 PE=3 SV=1 50 370 9.0E-98
sp|A8PTV6|GMT_MALGO GDP-mannose transporter OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=VRG4 PE=3 SV=1 59 379 1.0E-97
sp|Q6FRE5|GMT_CANGA GDP-mannose transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VRG4 PE=3 SV=1 52 370 6.0E-96
sp|Q753T9|GMT_ASHGO GDP-mannose transporter OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VRG4 PE=3 SV=2 50 373 4.0E-91
sp|A7TES5|GMT2_VANPO GDP-mannose transporter 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=VRG4-2 PE=3 SV=1 55 375 3.0E-89
sp|P0CE11|GMT2_YEAST Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HVG1 PE=3 SV=1 135 363 3.0E-75
sp|B5VHH5|GMT2_YEAS6 Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=HVG1 PE=3 SV=1 135 363 3.0E-75
sp|C7GSI5|GMT2_YEAS2 Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain JAY291) GN=HVG1 PE=3 SV=1 135 363 3.0E-75
sp|B3LS51|GMT2_YEAS1 Probable GDP-mannose transporter 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HVG1 PE=3 SV=1 135 363 3.0E-75
sp|Q941R4|GONS1_ARATH GDP-mannose transporter GONST1 OS=Arabidopsis thaliana GN=GONST1 PE=1 SV=2 62 370 1.0E-32
sp|Q84L09|GONS2_ARATH GDP-mannose transporter GONST2 OS=Arabidopsis thaliana GN=GONST2 PE=2 SV=1 63 367 3.0E-30
sp|Q95YI5|US74C_DROME UDP-sugar transporter UST74c OS=Drosophila melanogaster GN=frc PE=1 SV=2 38 371 5.0E-10
sp|Q9S845|GONS3_ARATH GDP-mannose transporter GONST3 OS=Arabidopsis thaliana GN=GONST3 PE=2 SV=1 18 397 4.0E-09
sp|Q54YK1|Y8631_DICDI Putative UDP-sugar transporter DDB_G0278631 OS=Dictyostelium discoideum GN=DDB_G0278631 PE=3 SV=2 77 345 2.0E-08
sp|Q15B89|S35D2_PIG UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter (Fragment) OS=Sus scrofa GN=SLC35D2 PE=2 SV=1 64 365 3.0E-08
sp|A2VE55|S35D2_BOVIN UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter OS=Bos taurus GN=SLC35D2 PE=2 SV=1 64 384 3.0E-08
sp|Q3UME2|TM241_MOUSE Transmembrane protein 241 OS=Mus musculus GN=Tmem241 PE=2 SV=2 62 269 8.0E-08
sp|Q9NTN3|S35D1_HUMAN UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter OS=Homo sapiens GN=SLC35D1 PE=1 SV=1 34 365 1.0E-07
sp|Q968A5|FUCT1_CAEEL GDP-fucose transporter OS=Caenorhabditis elegans GN=C50F4.14 PE=1 SV=1 60 389 1.0E-07
sp|Q8BLX4|FUCT1_MOUSE GDP-fucose transporter 1 OS=Mus musculus GN=Slc35c1 PE=2 SV=1 64 380 2.0E-07
sp|P0CD97|YR039_YEAST Uncharacterized protein YER039C-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER039C-A PE=1 SV=1 42 110 2.0E-07
sp|A6ZQY8|YR039_YEAS7 Uncharacterized protein SCY_1535 OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_1535 PE=3 SV=1 42 110 2.0E-07
sp|C7GSI6|YR039_YEAS2 Uncharacterized protein C1Q_03362 OS=Saccharomyces cerevisiae (strain JAY291) GN=C1Q_03362 PE=3 SV=1 42 110 2.0E-07
sp|B3LS52|YR039_YEAS1 Uncharacterized protein SCRG_04509 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_04509 PE=3 SV=1 42 110 2.0E-07
sp|Q5RDC9|S35D2_PONAB UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter OS=Pongo abelii GN=SLC35D2 PE=2 SV=1 34 365 3.0E-07
sp|Q84L08|GONS4_ARATH GDP-mannose transporter GONST4 OS=Arabidopsis thaliana GN=GONST4 PE=2 SV=1 45 331 3.0E-07
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 15 346 3.0E-07
sp|A1L3G4|TM241_XENLA Transmembrane protein 241 OS=Xenopus laevis GN=tmem241 PE=2 SV=1 57 278 5.0E-07
sp|Q18779|SQV7_CAEEL UDP-sugar transporter sqv-7 OS=Caenorhabditis elegans GN=sqv-7 PE=1 SV=1 60 369 5.0E-07
sp|A9UUB8|FUCT1_MONBE GDP-fucose transporter 1 OS=Monosiga brevicollis GN=slc35c1 PE=3 SV=1 61 326 1.0E-06
sp|Q76EJ3|S35D2_HUMAN UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter OS=Homo sapiens GN=SLC35D2 PE=1 SV=1 60 343 1.0E-06
sp|Q24JQ0|TM241_HUMAN Transmembrane protein 241 OS=Homo sapiens GN=TMEM241 PE=2 SV=1 62 269 3.0E-06
sp|A7S1L6|FUCT1_NEMVE GDP-fucose transporter 1 OS=Nematostella vectensis GN=slc35c1 PE=3 SV=1 59 385 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 86 105 19
3 125 147 22
4 160 182 22
5 216 238 22
6 255 272 17
7 292 314 22
8 321 340 19
9 344 366 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1047
MSDKKSDDFVVRMPDGTLRVEDEENGLLGNGSPREFRRPSALSASKASFLSSIEGSGGASVVAYCLSSISMTLVN
KYVVSGHQWNLHLLYLAIQSIVGTATIIACKQAGLIKDLDSFDAKRAQRWFPISLLLVGMIFTGNKALQFLSVPV
YTIFKNLTIIVIAYGEVMWFGGSVSPLTLVSFGLMVSSSMLAAWADFHNVKATVAGEALHGSSATATLSAGYAWM
GINVFCSALYVLSMRKAIKVTNLKNWDVMFYNNLLTVPVLLLSSLLMEDWSSANLHSNFPPASRQSLVIGMIYSG
LAAIFISYCTAWCIRATSSTTYAMAGALNKLPMAVAGLVFFSDPVTFGSVSAITLGFISGLIYTWAKNKKALQAS
LADSSRAASGPASPFEKGEAGKA*
Coding >Hirsu2|1047
ATGTCGGACAAGAAGAGCGACGACTTCGTCGTCCGCATGCCCGACGGCACGCTGCGCGTCGAGGATGAGGAGAAT
GGCCTCCTCGGCAACGGCTCGCCGCGCGAGTTTCGTCGCCCCTCGGCCCTGTCGGCTTCCAAGGCCTCCTTTCTC
TCGTCAATCGAAGGCAGCGGCGGCGCCTCCGTCGTCGCCTACTGCCTGTCGTCGATCAGCATGACGCTCGTCAAC
AAATACGTCGTCTCCGGGCACCAGTGGAATCTGCATCTGCTCTACCTGGCCATCCAGTCCATCGTCGGCACCGCG
ACCATCATCGCCTGCAAACAGGCCGGCCTGATCAAGGACCTGGACTCCTTCGACGCGAAACGAGCGCAACGATGG
TTCCCCATCTCGCTCCTCCTGGTCGGCATGATCTTCACCGGCAACAAGGCGCTGCAGTTCCTGTCGGTGCCCGTC
TACACCATCTTCAAGAACCTGACCATCATCGTCATCGCATACGGAGAGGTGATGTGGTTCGGCGGCAGCGTCAGC
CCGCTCACGCTCGTGTCCTTTGGGCTGATGGTGTCGAGCTCGATGCTGGCTGCCTGGGCCGACTTCCACAACGTC
AAGGCGACGGTGGCGGGCGAGGCGCTGCACGGGTCGTCGGCAACGGCGACGCTGAGCGCCGGGTACGCCTGGATG
GGCATCAACGTCTTCTGCTCGGCCCTGTACGTGCTGAGCATGCGCAAGGCGATCAAGGTGACGAATCTGAAGAAC
TGGGACGTCATGTTCTACAACAACCTGCTGACGGTGCCGGTGCTGCTGCTGTCGTCGCTGCTGATGGAGGACTGG
TCGTCGGCCAACCTTCACAGCAACTTCCCGCCGGCGTCGCGGCAGAGCCTGGTGATTGGCATGATCTACTCGGGC
CTGGCGGCCATCTTCATCTCGTACTGCACGGCCTGGTGCATCCGGGCGACGTCGTCGACGACGTACGCCATGGCG
GGAGCGCTCAACAAGCTGCCCATGGCCGTCGCCGGCCTCGTCTTCTTCTCGGACCCCGTCACGTTCGGCAGCGTC
TCGGCCATCACGCTCGGCTTCATCAGCGGCCTCATCTACACCTGGGCCAAGAACAAGAAGGCGCTGCAAGCCAGC
CTGGCCGACTCGAGCCGAGCGGCCTCGGGCCCGGCCTCGCCGTTTGAGAAGGGGGAGGCCGGCAAGGCATGA
Transcript >Hirsu2|1047
ATGTCGGACAAGAAGAGCGACGACTTCGTCGTCCGCATGCCCGACGGCACGCTGCGCGTCGAGGATGAGGAGAAT
GGCCTCCTCGGCAACGGCTCGCCGCGCGAGTTTCGTCGCCCCTCGGCCCTGTCGGCTTCCAAGGCCTCCTTTCTC
TCGTCAATCGAAGGCAGCGGCGGCGCCTCCGTCGTCGCCTACTGCCTGTCGTCGATCAGCATGACGCTCGTCAAC
AAATACGTCGTCTCCGGGCACCAGTGGAATCTGCATCTGCTCTACCTGGCCATCCAGTCCATCGTCGGCACCGCG
ACCATCATCGCCTGCAAACAGGCCGGCCTGATCAAGGACCTGGACTCCTTCGACGCGAAACGAGCGCAACGATGG
TTCCCCATCTCGCTCCTCCTGGTCGGCATGATCTTCACCGGCAACAAGGCGCTGCAGTTCCTGTCGGTGCCCGTC
TACACCATCTTCAAGAACCTGACCATCATCGTCATCGCATACGGAGAGGTGATGTGGTTCGGCGGCAGCGTCAGC
CCGCTCACGCTCGTGTCCTTTGGGCTGATGGTGTCGAGCTCGATGCTGGCTGCCTGGGCCGACTTCCACAACGTC
AAGGCGACGGTGGCGGGCGAGGCGCTGCACGGGTCGTCGGCAACGGCGACGCTGAGCGCCGGGTACGCCTGGATG
GGCATCAACGTCTTCTGCTCGGCCCTGTACGTGCTGAGCATGCGCAAGGCGATCAAGGTGACGAATCTGAAGAAC
TGGGACGTCATGTTCTACAACAACCTGCTGACGGTGCCGGTGCTGCTGCTGTCGTCGCTGCTGATGGAGGACTGG
TCGTCGGCCAACCTTCACAGCAACTTCCCGCCGGCGTCGCGGCAGAGCCTGGTGATTGGCATGATCTACTCGGGC
CTGGCGGCCATCTTCATCTCGTACTGCACGGCCTGGTGCATCCGGGCGACGTCGTCGACGACGTACGCCATGGCG
GGAGCGCTCAACAAGCTGCCCATGGCCGTCGCCGGCCTCGTCTTCTTCTCGGACCCCGTCACGTTCGGCAGCGTC
TCGGCCATCACGCTCGGCTTCATCAGCGGCCTCATCTACACCTGGGCCAAGAACAAGAAGGCGCTGCAAGCCAGC
CTGGCCGACTCGAGCCGAGCGGCCTCGGGCCCGGCCTCGCCGTTTGAGAAGGGGGAGGCCGGCAAGGCATGA
Gene >Hirsu2|1047
ATGTCGGACAAGAAGAGCGACGACTTCGTCGTCCGCATGCCCGACGGCACGCTGCGCGTCGAGGATGAGGAGAAT
GGCCTCCTCGGCAACGGCTCGCCGCGCGAGTTTCGTCGCCCCTCGGCCCTGTCGGCTTCCAAGGCCTCCTTTCTC
TCGTCAATCGAAGGCAGCGGCGGCGCCTCCGTCGTCGCCTACTGCCTGTCGTCGATCAGCATGACGCTCGTCAAC
AAATACGTCGTCTCCGGGCACCAGTGGAATCTGCATCTGCTCTACCTGGCCATCCAGGTATGCCGCTCTCGCTTT
GACCTCGTTTTGTTTTTGTCTGCTCGCCCCACCGCCAGAGGCTGACCGAGGGCGGGAAAACGACAGTCCATCGTC
GGCACCGCGACCATCATCGCCTGCAAACAGGCCGGCCTGATCAAGGACCTGGACTCCTTCGACGCGAAACGAGCG
CAACGATGTGAGGGGAAAAAAAAGACCGCGAGCTGCTGTGGCCTCGGCTGACCGGGTGTTACAACAGGGTTCCCC
ATCTCGCTCCTCCTGGTCGGCATGATCTTCACCGGCAACAAGGCGCTGCAGTTCCTGTCGGTGCCCGTCTACACC
ATCTTCAAGAACCTGACCATCATCGTCATCGCATACGGAGAGGTGATGTGGTTCGGCGGCAGCGTCAGCCCGCTC
ACGCTCGTGTCCTTTGGGCTGATGGTGTCGAGCTCGATGCTGGCTGCCTGGGCCGACTTCCACAACGTCAAGGCG
ACGGTGGCGGGCGAGGCGCTGCACGGGTCGTCGGCAACGGCGACGCTGAGCGCCGGGTACGCCTGGATGGGCATC
AACGTCTTCTGCTCGGCCCTGTACGTGCTGAGCATGCGCAAGGCGATCAAGGTGACGAATCTGAAGAACTGGGAC
GGTAGGTGGCACCGCAGCATGTTTGGAGGGTGGGTCGCTGACGCGAGAGGGCAGTCATGTTCTACAACAACCTGC
TGACGGTGCCGGTGCTGCTGCTGTCGTCGCTGCTGATGGAGGACTGGTCGTCGGCCAACCTTCACAGCAACTTCC
CGCCGGCGTCGCGGCAGAGCCTGGTGATTGGCATGATCTACTCGGGCCTGGCGGCCATCTTCATCTCGTACTGCA
CGGCCTGGTGCATCCGGGCGACGTCGTCGACGACGTACGCCATGGCGGGAGCGCTCAACAAGCTGCCCATGGCCG
TCGCCGGCCTCGTCTTCTTCTCGGACCCCGTCACGTTCGGCAGCGTCTCGGCCATCACGCTCGGCTTCATCAGCG
GCCTCATCTACACCTGGGCCAAGAACAAGAAGGCGCTGCAAGCCAGCCTGGCCGACTCGAGCCGAGCGGCCTCGG
GCCCGGCCTCGCCGTTTGAGAAGGGGGAGGCCGGCAAGGCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail