Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10466
Gene name
LocationContig_85:12049..13052
Strand-
Gene length (bp)1003
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 1.1E-08 180 246

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW5|YFW6_SCHPO UPF0644 protein PB2B4.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB2B4.06 PE=3 SV=2 93 278 6.0E-27
sp|O74793|YOUB_SCHPO Uncharacterized protein C26H8.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.11c PE=4 SV=1 102 279 1.0E-22
sp|P53716|YBJ5_CANAW Uncharacterized protein CAWG_04269, mitochondrial OS=Candida albicans (strain WO-1) GN=CAWG_04269 PE=2 SV=2 113 270 1.0E-19
sp|Q3UUI3|THEM4_MOUSE Acyl-coenzyme A thioesterase THEM4 OS=Mus musculus GN=Them4 PE=1 SV=1 162 267 3.0E-14
sp|P38172|MRX3_YEAST MIOREX complex component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX3 PE=1 SV=1 128 247 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW5|YFW6_SCHPO UPF0644 protein PB2B4.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB2B4.06 PE=3 SV=2 93 278 6.0E-27
sp|O74793|YOUB_SCHPO Uncharacterized protein C26H8.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.11c PE=4 SV=1 102 279 1.0E-22
sp|P53716|YBJ5_CANAW Uncharacterized protein CAWG_04269, mitochondrial OS=Candida albicans (strain WO-1) GN=CAWG_04269 PE=2 SV=2 113 270 1.0E-19
sp|Q3UUI3|THEM4_MOUSE Acyl-coenzyme A thioesterase THEM4 OS=Mus musculus GN=Them4 PE=1 SV=1 162 267 3.0E-14
sp|P38172|MRX3_YEAST MIOREX complex component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX3 PE=1 SV=1 128 247 4.0E-14
sp|Q566R0|THEM4_RAT Acyl-coenzyme A thioesterase THEM4 OS=Rattus norvegicus GN=Them4 PE=2 SV=1 156 267 1.0E-13
sp|P40098|FMP10_YEAST Uncharacterized mitochondrial membrane protein FMP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP10 PE=1 SV=1 25 270 3.0E-13
sp|Q5T1C6|THEM4_HUMAN Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens GN=THEM4 PE=1 SV=1 162 267 4.0E-13
sp|A1A4L1|THEM4_BOVIN Acyl-coenzyme A thioesterase THEM4 OS=Bos taurus GN=THEM4 PE=2 SV=1 162 267 2.0E-12
sp|Q6GLK2|THEM4_XENLA Acyl-coenzyme A thioesterase THEM4 OS=Xenopus laevis GN=them4 PE=2 SV=2 156 267 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10466
MSSWHIGRHIVRRKVASWRCPDGNRISWLQCRAYAARAESPAGGGALRKGLSLALFGLAFSAAGAATAWKTLTAQ
GMGFYSDEASLQRFSVADADEEARRIEETMQGLPLVAEMRSRPEMTESRPHMKMPAQYRAHSLTAGALSGPGKVP
VPSMTWVEQGGKSLVSVVYVGHDLCGHPNLVHGGFLATMLDEGLAWCCFGALPHNIGMTANLNVNYRKPTPAGSF
LVLRAKTTRVEGRKAWVEGHIELLAKPGQEPTVVVEADALYVSPKHAALMPRIR*
Coding >Hirsu2|10466
ATGTCCAGCTGGCATATCGGACGCCACATCGTGCGACGAAAGGTAGCATCATGGCGGTGTCCCGACGGGAATCGG
ATCTCCTGGCTTCAATGCCGGGCGTATGCGGCGCGGGCAGAATCGCCAGCGGGCGGCGGAGCGCTCCGCAAGGGC
CTCTCACTGGCCCTGTTCGGCCTCGCCTTTAGCGCGGCGGGCGCGGCGACGGCGTGGAAGACGCTGACGGCGCAG
GGGATGGGCTTCTACTCGGACGAGGCCAGCCTGCAGAGGTTCTCGGTGGCTGACGCGGACGAGGAGGCGCGCCGG
ATCGAGGAAACGATGCAGGGGCTCCCGCTGGTGGCGGAGATGCGCAGCAGGCCCGAGATGACCGAGTCGCGGCCG
CACATGAAGATGCCGGCACAGTACCGCGCCCACAGCCTGACGGCCGGCGCGCTCTCGGGCCCGGGCAAGGTGCCG
GTGCCGTCCATGACGTGGGTAGAGCAGGGCGGCAAGTCGCTCGTCTCCGTCGTCTACGTCGGCCACGACCTCTGC
GGGCACCCCAACCTCGTGCACGGCGGCTTCCTCGCCACGATGCTGGACGAGGGTCTGGCCTGGTGCTGCTTCGGC
GCGCTGCCGCACAACATTGGCATGACGGCCAACCTCAACGTCAACTACCGCAAGCCGACACCCGCCGGCAGCTTC
CTCGTGCTCCGGGCCAAGACGACGCGGGTTGAGGGGCGGAAGGCCTGGGTCGAGGGCCACATCGAGCTGCTCGCC
AAGCCCGGCCAGGAGCCGACGGTGGTGGTCGAGGCCGACGCGCTCTACGTCTCGCCCAAACACGCCGCTTTGATG
CCACGCATACGCTAG
Transcript >Hirsu2|10466
ATGTCCAGCTGGCATATCGGACGCCACATCGTGCGACGAAAGGTAGCATCATGGCGGTGTCCCGACGGGAATCGG
ATCTCCTGGCTTCAATGCCGGGCGTATGCGGCGCGGGCAGAATCGCCAGCGGGCGGCGGAGCGCTCCGCAAGGGC
CTCTCACTGGCCCTGTTCGGCCTCGCCTTTAGCGCGGCGGGCGCGGCGACGGCGTGGAAGACGCTGACGGCGCAG
GGGATGGGCTTCTACTCGGACGAGGCCAGCCTGCAGAGGTTCTCGGTGGCTGACGCGGACGAGGAGGCGCGCCGG
ATCGAGGAAACGATGCAGGGGCTCCCGCTGGTGGCGGAGATGCGCAGCAGGCCCGAGATGACCGAGTCGCGGCCG
CACATGAAGATGCCGGCACAGTACCGCGCCCACAGCCTGACGGCCGGCGCGCTCTCGGGCCCGGGCAAGGTGCCG
GTGCCGTCCATGACGTGGGTAGAGCAGGGCGGCAAGTCGCTCGTCTCCGTCGTCTACGTCGGCCACGACCTCTGC
GGGCACCCCAACCTCGTGCACGGCGGCTTCCTCGCCACGATGCTGGACGAGGGTCTGGCCTGGTGCTGCTTCGGC
GCGCTGCCGCACAACATTGGCATGACGGCCAACCTCAACGTCAACTACCGCAAGCCGACACCCGCCGGCAGCTTC
CTCGTGCTCCGGGCCAAGACGACGCGGGTTGAGGGGCGGAAGGCCTGGGTCGAGGGCCACATCGAGCTGCTCGCC
AAGCCCGGCCAGGAGCCGACGGTGGTGGTCGAGGCCGACGCGCTCTACGTCTCGCCCAAACACGCCGCTTTGATG
CCACGCATACGCTAG
Gene >Hirsu2|10466
ATGTCCAGCTGGCATATCGGACGCCACATCGTGCGACGAAAGGTAGCATCATGGCGGTGTCCCGACGGGAATCGG
ATCTCCTGGCTTCAATGCCGGGCGTATGCGGCGCGGGCAGGTAGGAGTAAACCCCCAACTCTTCGGCGTCTCCGA
CTACAGCTCACGACTACACGGCTGGCTGACGAGTTGTCCCGCGTGGCAGAATCGCCAGCGGGCGGCGGAGCGCTC
CGCAAGGGCCTCTCACTGGCCCTGTTCGGCCTCGCCTTTAGCGCGGCGGGCGCGGCGACGGCGTGGAAGACGCTG
ACGGCGCAGGGGATGGGCTTCTACTCGGACGAGGCCAGCCTGCAGAGGTTCTCGGTGGCTGACGCGGACGAGGAG
GCGCGCCGGATCGAGGAAACGATGCAGGGGCTCCCGCTGGTGGCGGAGATGCGCAGCAGGCCCGAGATGACCGAG
TCGCGGCCGCACATGAAGATGCCGGCACAGTACCGCGCCCACAGCCTGACGGCCGGCGCGCTCTCGGGCCCGGGC
AAGGTGCCGGTGCCGTCCATGACGTGGGTAGAGCAGGGCGGCAAGTCGCTCGTCTCCGTCGTCTACGTCGGCCAC
GACCTCTGCGGGCACCCCAACCTCGTGCACGGCGGCTTCCTCGCCACGATGCTGGACGAGGGTCTGGCCTGGTGC
TGCTTCGGCGCGCTGCCGCACAACATTGGCATGACGGCCAACCTCAACGTCAACTACCGCAAGCCGACACCCGCC
GGCAGCTTCCTCGTGCTCCGGGCCAAGACGACGCGGGTTGAGGGGCGGAAGGCCTGGGTCGAGGGCCACATCGAG
CTGCTCGCCAAGCCCGGCCAGGAGCCGACGGTGGTGGTCGAGGCCGACGCGCTCTACGTCTCGCCCAAACACGCC
GCTGTGAGTTGCGCTGTGTCCCCTCTCGCTCTGTATGGGCGTCTTCCCGCGGCCCGGCTGACTTGCGGTCCCGTC
TCTGCAGTTGATGCCACGCATACGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail