Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10465
Gene name
LocationContig_85:10058..11055
Strand-
Gene length (bp)997
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01583 APS_kinase Adenylylsulphate kinase 1.2E-71 23 186
PF13671 AAA_33 AAA domain 1.6E-06 27 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92203|KAPS_EMENI Adenylyl-sulfate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sD PE=3 SV=2 1 201 2.0E-100
sp|Q9C2Y6|KAPS_SACPS Adenylyl-sulfate kinase OS=Saccharomyces pastorianus GN=MET14 PE=3 SV=1 1 206 1.0E-97
sp|Q9HGF8|KAPS_SACBA Adenylyl-sulfate kinase OS=Saccharomyces bayanus GN=MET14 PE=3 SV=1 1 206 4.0E-97
sp|Q12657|KAPS_PENCH Adenylyl-sulfate kinase OS=Penicillium chrysogenum PE=1 SV=1 1 204 5.0E-97
sp|Q02196|KAPS_YEAST Adenylyl-sulfate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET14 PE=1 SV=1 1 206 7.0E-97
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92203|KAPS_EMENI Adenylyl-sulfate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sD PE=3 SV=2 1 201 2.0E-100
sp|Q9C2Y6|KAPS_SACPS Adenylyl-sulfate kinase OS=Saccharomyces pastorianus GN=MET14 PE=3 SV=1 1 206 1.0E-97
sp|Q9HGF8|KAPS_SACBA Adenylyl-sulfate kinase OS=Saccharomyces bayanus GN=MET14 PE=3 SV=1 1 206 4.0E-97
sp|Q12657|KAPS_PENCH Adenylyl-sulfate kinase OS=Penicillium chrysogenum PE=1 SV=1 1 204 5.0E-97
sp|Q02196|KAPS_YEAST Adenylyl-sulfate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET14 PE=1 SV=1 1 206 7.0E-97
sp|Q9P7G9|KAPS_SCHPO Adenylyl-sulfate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met14 PE=3 SV=1 1 204 8.0E-95
sp|Q97MT8|CYSC_CLOAB Adenylyl-sulfate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cysC PE=3 SV=1 2 198 3.0E-75
sp|Q4L9E6|CYSC_STAHJ Adenylyl-sulfate kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysC PE=3 SV=1 2 201 5.0E-73
sp|A5N960|CYSC_CLOK5 Adenylyl-sulfate kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=cysC PE=3 SV=1 2 201 8.0E-73
sp|Q88X60|CYSC_LACPL Adenylyl-sulfate kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cysC PE=3 SV=1 4 204 5.0E-69
sp|B9DLK2|CYSC_STACT Adenylyl-sulfate kinase OS=Staphylococcus carnosus (strain TM300) GN=cysC PE=3 SV=1 2 204 1.0E-68
sp|A1U3X8|CYSC_MARHV Adenylyl-sulfate kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=cysC PE=3 SV=1 3 205 2.0E-68
sp|Q5HL02|CYSC_STAEQ Adenylyl-sulfate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysC PE=3 SV=1 2 204 5.0E-68
sp|Q8CR04|CYSC_STAES Adenylyl-sulfate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysC PE=3 SV=1 2 204 7.0E-68
sp|Q49UM5|CYSC_STAS1 Adenylyl-sulfate kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysC PE=3 SV=1 1 198 1.0E-67
sp|Q8EQN3|CYSC_OCEIH Adenylyl-sulfate kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysC PE=3 SV=1 2 204 4.0E-67
sp|O43252|PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2 2 201 6.0E-67
sp|Q60967|PAPS1_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus GN=Papss1 PE=1 SV=1 2 201 7.0E-67
sp|O49196|APK2_ARATH Adenylyl-sulfate kinase 2, chloroplastic OS=Arabidopsis thaliana GN=APK2 PE=1 SV=1 2 205 1.0E-66
sp|O54820|PAPS1_CAVPO Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Cavia porcellus GN=PAPSS1 PE=2 SV=1 2 201 1.0E-66
sp|Q27128|PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo PE=2 SV=1 1 206 2.0E-66
sp|Q9SRW7|APK3_ARATH Adenylyl-sulfate kinase 3 OS=Arabidopsis thaliana GN=APK3 PE=1 SV=1 2 206 7.0E-66
sp|Q43295|APK1_ARATH Adenylyl-sulfate kinase 1, chloroplastic OS=Arabidopsis thaliana GN=APK1 PE=1 SV=1 2 205 7.0E-66
sp|A1S9N4|CYSC_SHEAM Adenylyl-sulfate kinase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cysC PE=3 SV=1 3 204 3.0E-65
sp|Q9KCT0|CYSC1_BACHD Probable adenylyl-sulfate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH1489 PE=3 SV=1 4 198 5.0E-65
sp|Q9KP21|CYSC_VIBCH Adenylyl-sulfate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysC PE=3 SV=1 4 206 7.0E-65
sp|Q8ZBP3|CYSC_YERPE Adenylyl-sulfate kinase OS=Yersinia pestis GN=cysC PE=3 SV=1 4 205 2.0E-64
sp|Q87SX6|CYSC_VIBPA Adenylyl-sulfate kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysC PE=3 SV=1 4 191 5.0E-64
sp|Q65JT8|CYSC_BACLD Adenylyl-sulfate kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysC PE=3 SV=1 4 201 6.0E-64
sp|B2VG00|CYSC_ERWT9 Adenylyl-sulfate kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysC PE=3 SV=1 4 200 9.0E-64
sp|Q7MPF0|CYSC_VIBVY Adenylyl-sulfate kinase OS=Vibrio vulnificus (strain YJ016) GN=cysC PE=3 SV=1 4 204 1.0E-63
sp|Q8DE75|CYSC_VIBVU Adenylyl-sulfate kinase OS=Vibrio vulnificus (strain CMCP6) GN=cysC PE=3 SV=1 4 204 1.0E-63
sp|O06735|CYSC2_BACSU Probable adenylyl-sulfate kinase OS=Bacillus subtilis (strain 168) GN=yisZ PE=3 SV=2 4 204 2.0E-63
sp|A8FD25|CYSC_BACP2 Adenylyl-sulfate kinase OS=Bacillus pumilus (strain SAFR-032) GN=cysC PE=3 SV=1 4 201 6.0E-63
sp|Q7VE24|CYSC_PROMA Adenylyl-sulfate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=cysC PE=3 SV=1 2 205 1.0E-62
sp|A7Z4I0|CYSC_BACMF Adenylyl-sulfate kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysC PE=3 SV=1 4 200 4.0E-62
sp|B9M543|CYSC_GEODF Adenylyl-sulfate kinase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=cysC PE=3 SV=1 4 205 6.0E-62
sp|O88428|PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus GN=Papss2 PE=1 SV=2 2 201 6.0E-62
sp|A7MJ70|CYSC_CROS8 Adenylyl-sulfate kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysC PE=3 SV=1 4 205 7.0E-62
sp|A4WDV5|CYSC_ENT38 Adenylyl-sulfate kinase OS=Enterobacter sp. (strain 638) GN=cysC PE=3 SV=1 4 198 8.0E-62
sp|Q84JF0|APK4_ARATH Adenylyl-sulfate kinase 4, chloroplastic OS=Arabidopsis thaliana GN=APK4 PE=1 SV=1 4 182 1.0E-61
sp|A4SRG6|CYSC_AERS4 Adenylyl-sulfate kinase OS=Aeromonas salmonicida (strain A449) GN=cysC PE=3 SV=1 3 180 1.0E-61
sp|O34577|CYSC1_BACSU Probable adenylyl-sulfate kinase OS=Bacillus subtilis (strain 168) GN=cysC PE=2 SV=1 4 201 3.0E-61
sp|O95340|PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2 2 201 5.0E-61
sp|A5G863|CYSC_GEOUR Adenylyl-sulfate kinase OS=Geobacter uraniireducens (strain Rf4) GN=cysC PE=3 SV=1 4 204 7.0E-61
sp|A8H0A6|CYSC_SHEPA Adenylyl-sulfate kinase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cysC PE=3 SV=1 3 199 8.0E-61
sp|A9MF25|CYSC_SALAR Adenylyl-sulfate kinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysC PE=3 SV=1 4 198 8.0E-61
sp|C0PXB0|CYSC_SALPC Adenylyl-sulfate kinase OS=Salmonella paratyphi C (strain RKS4594) GN=cysC PE=3 SV=1 4 198 1.0E-60
sp|Q57KJ1|CYSC_SALCH Adenylyl-sulfate kinase OS=Salmonella choleraesuis (strain SC-B67) GN=cysC PE=3 SV=1 4 198 1.0E-60
sp|A6TD42|CYSC_KLEP7 Adenylyl-sulfate kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysC PE=3 SV=1 4 200 1.0E-60
sp|B5XV31|CYSC_KLEP3 Adenylyl-sulfate kinase OS=Klebsiella pneumoniae (strain 342) GN=cysC PE=3 SV=1 4 200 1.0E-60
sp|B7LWK5|CYSC_ESCF3 Adenylyl-sulfate kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysC PE=3 SV=1 4 200 2.0E-60
sp|B5YJA6|CYSC_THEYD Adenylyl-sulfate kinase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cysC PE=3 SV=1 3 201 2.0E-60
sp|Q1R7U1|CYSC_ECOUT Adenylyl-sulfate kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysC PE=3 SV=1 4 200 4.0E-60
sp|Q8FEJ2|CYSC_ECOL6 Adenylyl-sulfate kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysC PE=3 SV=3 4 200 4.0E-60
sp|A1AEU4|CYSC_ECOK1 Adenylyl-sulfate kinase OS=Escherichia coli O1:K1 / APEC GN=cysC PE=3 SV=1 4 200 4.0E-60
sp|B7MYQ5|CYSC_ECO81 Adenylyl-sulfate kinase OS=Escherichia coli O81 (strain ED1a) GN=cysC PE=3 SV=1 4 200 4.0E-60
sp|B7NT94|CYSC_ECO7I Adenylyl-sulfate kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysC PE=3 SV=1 4 200 4.0E-60
sp|B7MKM4|CYSC_ECO45 Adenylyl-sulfate kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysC PE=3 SV=1 4 200 4.0E-60
sp|B7UHG9|CYSC_ECO27 Adenylyl-sulfate kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysC PE=3 SV=1 4 200 4.0E-60
sp|B5RDQ6|CYSC_SALG2 Adenylyl-sulfate kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysC PE=3 SV=1 4 198 5.0E-60
sp|O49204|KAPS_CATRO Adenylyl-sulfate kinase, chloroplastic OS=Catharanthus roseus GN=AKN PE=2 SV=1 2 180 1.0E-59
sp|Q1I2K4|CYSC_PSEE4 Adenylyl-sulfate kinase OS=Pseudomonas entomophila (strain L48) GN=cysC PE=3 SV=1 4 206 2.0E-59
sp|Q0TEA8|CYSC_ECOL5 Adenylyl-sulfate kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysC PE=3 SV=1 4 200 2.0E-59
sp|B0TTD2|CYSC_SHEHH Adenylyl-sulfate kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cysC PE=3 SV=1 3 199 2.0E-59
sp|A0KP33|CYSC_AERHH Adenylyl-sulfate kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysC PE=3 SV=1 3 180 2.0E-59
sp|P63889|CYSC_SALTY Adenylyl-sulfate kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysC PE=3 SV=2 4 198 2.0E-59
sp|P63890|CYSC_SALTI Adenylyl-sulfate kinase OS=Salmonella typhi GN=cysC PE=3 SV=2 4 198 2.0E-59
sp|B4TTW4|CYSC_SALSV Adenylyl-sulfate kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysC PE=3 SV=1 4 198 2.0E-59
sp|A9N2D7|CYSC_SALPB Adenylyl-sulfate kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysC PE=3 SV=1 4 198 2.0E-59
sp|B4T460|CYSC_SALNS Adenylyl-sulfate kinase OS=Salmonella newport (strain SL254) GN=cysC PE=3 SV=1 4 198 2.0E-59
sp|B4TFX0|CYSC_SALHS Adenylyl-sulfate kinase OS=Salmonella heidelberg (strain SL476) GN=cysC PE=3 SV=1 4 198 2.0E-59
sp|B5QW21|CYSC_SALEP Adenylyl-sulfate kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysC PE=3 SV=1 4 198 2.0E-59
sp|B5FTS8|CYSC_SALDC Adenylyl-sulfate kinase OS=Salmonella dublin (strain CT_02021853) GN=cysC PE=3 SV=1 4 198 2.0E-59
sp|B5F414|CYSC_SALA4 Adenylyl-sulfate kinase OS=Salmonella agona (strain SL483) GN=cysC PE=3 SV=1 4 198 2.0E-59
sp|B5BEY7|CYSC_SALPK Adenylyl-sulfate kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysC PE=3 SV=1 4 198 3.0E-59
sp|Q5PEH3|CYSC_SALPA Adenylyl-sulfate kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysC PE=3 SV=1 4 198 3.0E-59
sp|A8ANW4|CYSC_CITK8 Adenylyl-sulfate kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysC PE=3 SV=1 4 194 4.0E-59
sp|B2TZI1|CYSC_SHIB3 Adenylyl-sulfate kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysC PE=3 SV=1 4 200 4.0E-59
sp|Q3YYB2|CYSC_SHISS Adenylyl-sulfate kinase OS=Shigella sonnei (strain Ss046) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|Q0T1I1|CYSC_SHIF8 Adenylyl-sulfate kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|Q32CI0|CYSC_SHIDS Adenylyl-sulfate kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|Q31XB2|CYSC_SHIBS Adenylyl-sulfate kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|B1LQ71|CYSC_ECOSM Adenylyl-sulfate kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|B6I6E0|CYSC_ECOSE Adenylyl-sulfate kinase OS=Escherichia coli (strain SE11) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|B7N6Y0|CYSC_ECOLU Adenylyl-sulfate kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|P0A6J1|CYSC_ECOLI Adenylyl-sulfate kinase OS=Escherichia coli (strain K12) GN=cysC PE=1 SV=2 4 200 5.0E-59
sp|A8A3M9|CYSC_ECOHS Adenylyl-sulfate kinase OS=Escherichia coli O9:H4 (strain HS) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|B1XCS6|CYSC_ECODH Adenylyl-sulfate kinase OS=Escherichia coli (strain K12 / DH10B) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|C4ZZQ4|CYSC_ECOBW Adenylyl-sulfate kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|B7LXG2|CYSC_ECO8A Adenylyl-sulfate kinase OS=Escherichia coli O8 (strain IAI1) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|B5Z3B2|CYSC_ECO5E Adenylyl-sulfate kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|P0A6J2|CYSC_ECO57 Adenylyl-sulfate kinase OS=Escherichia coli O157:H7 GN=cysC PE=3 SV=2 4 200 5.0E-59
sp|B7LEG8|CYSC_ECO55 Adenylyl-sulfate kinase OS=Escherichia coli (strain 55989 / EAEC) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|A7ZQJ4|CYSC_ECO24 Adenylyl-sulfate kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysC PE=3 SV=1 4 200 5.0E-59
sp|Q12QM6|CYSC_SHEDO Adenylyl-sulfate kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cysC PE=3 SV=1 3 198 2.0E-58
sp|Q07Y94|CYSC_SHEFN Adenylyl-sulfate kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cysC PE=3 SV=1 3 198 2.0E-58
sp|B1IUS9|CYSC_ECOLC Adenylyl-sulfate kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysC PE=3 SV=1 4 200 3.0E-58
sp|A6WJU6|CYSC_SHEB8 Adenylyl-sulfate kinase OS=Shewanella baltica (strain OS185) GN=cysC PE=3 SV=1 3 198 3.0E-58
sp|B8EE63|CYSC_SHEB2 Adenylyl-sulfate kinase OS=Shewanella baltica (strain OS223) GN=cysC PE=3 SV=1 3 198 3.0E-58
sp|B8D0S4|CYSC_HALOH Adenylyl-sulfate kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=cysC PE=3 SV=1 19 204 3.0E-58
sp|Q83JX9|CYSC_SHIFL Adenylyl-sulfate kinase OS=Shigella flexneri GN=cysC PE=3 SV=1 4 200 5.0E-58
sp|A0KTI5|CYSC_SHESA Adenylyl-sulfate kinase OS=Shewanella sp. (strain ANA-3) GN=cysC PE=3 SV=1 3 205 6.0E-58
sp|Q9K7H6|CYSC2_BACHD Probable adenylyl-sulfate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH3385 PE=3 SV=1 2 207 9.0E-58
sp|P72339|NODQ_RHIS3 Bifunctional enzyme NodQ OS=Rhizobium sp. (strain N33) GN=nodQ PE=3 SV=1 2 201 1.0E-57
sp|Q0HFM7|CYSC_SHESM Adenylyl-sulfate kinase OS=Shewanella sp. (strain MR-4) GN=cysC PE=3 SV=1 3 198 1.0E-57
sp|A9L392|CYSC_SHEB9 Adenylyl-sulfate kinase OS=Shewanella baltica (strain OS195) GN=cysC PE=3 SV=1 3 198 1.0E-57
sp|Q0HYA3|CYSC_SHESR Adenylyl-sulfate kinase OS=Shewanella sp. (strain MR-7) GN=cysC PE=3 SV=1 3 198 1.0E-57
sp|A1RGG0|CYSC_SHESW Adenylyl-sulfate kinase OS=Shewanella sp. (strain W3-18-1) GN=cysC PE=3 SV=1 3 198 2.0E-57
sp|A4Y9X0|CYSC_SHEPC Adenylyl-sulfate kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cysC PE=3 SV=1 3 198 2.0E-57
sp|A3D819|CYSC_SHEB5 Adenylyl-sulfate kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cysC PE=3 SV=1 3 198 2.0E-57
sp|Q5LES5|CYSC_BACFN Adenylyl-sulfate kinase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysC PE=3 SV=1 11 194 3.0E-56
sp|Q8EB13|CYSC_SHEON Adenylyl-sulfate kinase OS=Shewanella oneidensis (strain MR-1) GN=cysC PE=3 SV=1 3 198 4.0E-56
sp|B0CAX3|CYSC_ACAM1 Adenylyl-sulfate kinase OS=Acaryochloris marina (strain MBIC 11017) GN=cysC PE=3 SV=1 2 205 8.0E-56
sp|Q8DJ87|CYSC_THEEB Adenylyl-sulfate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=cysC PE=3 SV=1 4 206 9.0E-56
sp|Q64VR1|CYSC_BACFR Adenylyl-sulfate kinase OS=Bacteroides fragilis (strain YCH46) GN=cysC PE=3 SV=1 11 194 3.0E-55
sp|Q8AAQ1|CYSC_BACTN Adenylyl-sulfate kinase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysC PE=3 SV=1 11 201 6.0E-55
sp|P52978|NODQ_RHITR Bifunctional enzyme NodQ OS=Rhizobium tropici GN=nodQ PE=3 SV=1 2 198 1.0E-54
sp|Q9PD78|CYSNC_XYLFA Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain 9a5c) GN=cysNC PE=3 SV=2 2 198 5.0E-54
sp|Q87DG7|CYSNC_XYLFT Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysNC PE=3 SV=1 2 202 6.0E-54
sp|B7K5B1|CYSC_CYAP8 Adenylyl-sulfate kinase OS=Cyanothece sp. (strain PCC 8801) GN=cysC PE=3 SV=1 21 206 9.0E-54
sp|A6KXG9|CYSC_BACV8 Adenylyl-sulfate kinase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=cysC PE=3 SV=1 11 191 2.0E-53
sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 2 198 2.0E-53
sp|P57702|CYSC_PSEAE Adenylyl-sulfate kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysC PE=3 SV=1 16 198 6.0E-53
sp|P29811|CYSC_PSEAI Probable adenylyl-sulfate kinase OS=Pseudomonas aeruginosa PE=3 SV=1 24 196 6.0E-53
sp|P57497|CYSC_BUCAI Adenylyl-sulfate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysC PE=3 SV=1 3 185 2.0E-52
sp|Q2JUC0|CYSC_SYNJA Adenylyl-sulfate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=cysC PE=3 SV=1 22 205 2.0E-52
sp|B0JL16|CYSC_MICAN Adenylyl-sulfate kinase OS=Microcystis aeruginosa (strain NIES-843) GN=cysC PE=3 SV=1 21 206 2.0E-52
sp|Q7UQW3|CYSC_RHOBA Adenylyl-sulfate kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysC PE=3 SV=2 4 202 6.0E-52
sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 2 182 3.0E-51
sp|P28604|NODQ_AZOBR Bifunctional enzyme NodQ OS=Azospirillum brasilense GN=nodQ PE=3 SV=2 15 202 9.0E-51
sp|Q2JLM3|CYSC_SYNJB Adenylyl-sulfate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=cysC PE=3 SV=1 22 204 1.0E-50
sp|B7K8N5|CYSC_CYAP7 Adenylyl-sulfate kinase OS=Cyanothece sp. (strain PCC 7424) GN=cysC PE=3 SV=1 21 205 1.0E-49
sp|P9WNM5|CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 18 198 2.0E-49
sp|P9WNM4|CYSNC_MYCTO Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 18 198 2.0E-49
sp|Q0BI00|CYSC_BURCM Adenylyl-sulfate kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=cysC PE=3 SV=1 19 198 5.0E-49
sp|Q8K9D4|CYSC_BUCAP Adenylyl-sulfate kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysC PE=3 SV=1 4 204 6.0E-49
sp|B2T3K5|CYSC_BURPP Adenylyl-sulfate kinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=cysC PE=3 SV=1 23 202 4.0E-48
sp|B1XN05|CYSC_SYNP2 Adenylyl-sulfate kinase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cysC PE=3 SV=1 22 204 1.0E-47
sp|P72940|CYSC_SYNY3 Probable adenylyl-sulfate kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysC PE=1 SV=1 21 205 5.0E-47
sp|Q13ZJ7|CYSC_BURXL Adenylyl-sulfate kinase OS=Burkholderia xenovorans (strain LB400) GN=cysC PE=3 SV=1 23 204 2.0E-46
sp|A9ENT2|SATC1_SORC5 Probable bifunctional SAT/APS kinase 1 OS=Sorangium cellulosum (strain So ce56) GN=sat1/cysC1 PE=3 SV=1 24 205 4.0E-42
sp|Q1D6P1|CYSC_MYXXD Adenylyl-sulfate kinase OS=Myxococcus xanthus (strain DK 1622) GN=cysC PE=3 SV=1 21 202 5.0E-42
sp|A9G7W0|SATC2_SORC5 Probable bifunctional SAT/APS kinase 2 OS=Sorangium cellulosum (strain So ce56) GN=sat2/cysC2 PE=3 SV=1 24 206 5.0E-42
sp|B9LKC1|CYSC_CHLSY Adenylyl-sulfate kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=cysC PE=3 SV=1 24 191 6.0E-42
sp|P56861|CYSC_DEIRA Adenylyl-sulfate kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=cysC PE=3 SV=1 24 200 2.0E-41
sp|Q9YCR6|CYSC_AERPE Probable adenylyl-sulfate kinase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cysC PE=1 SV=2 22 194 2.0E-41
sp|Q1IYI1|CYSC_DEIGD Adenylyl-sulfate kinase OS=Deinococcus geothermalis (strain DSM 11300) GN=cysC PE=3 SV=1 17 199 4.0E-41
sp|O67174|SATC_AQUAE Probable bifunctional SAT/APS kinase OS=Aquifex aeolicus (strain VF5) GN=sat/cysC PE=1 SV=1 20 205 2.0E-39
sp|C1CVW7|CYSC_DEIDV Adenylyl-sulfate kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=cysC PE=3 SV=1 24 194 6.0E-38
sp|O29953|CYSC_ARCFU Probable adenylyl-sulfate kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cysC PE=3 SV=1 25 185 7.0E-36
sp|P56858|CYSC_PYRAB Probable adenylyl-sulfate kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cysC PE=3 SV=1 24 204 1.0E-35
sp|Q7UMW2|CYSNC_RHOBA Bifunctional enzyme CysN/CysC OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysNC PE=3 SV=1 11 205 2.0E-32
sp|Q4WWN8|MET3_ASPFU Sulfate adenylyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=met3 PE=3 SV=1 14 202 9.0E-31
sp|A1D858|MET3_NEOFI Sulfate adenylyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=met3 PE=3 SV=1 14 202 1.0E-30
sp|Q8NJN1|MET3_ASPNG Sulfate adenylyltransferase OS=Aspergillus niger GN=met3 PE=3 SV=1 14 206 3.0E-29
sp|Q8NK83|MET3_ASPOR Sulfate adenylyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=met3 PE=3 SV=1 14 202 3.0E-28
sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 11 204 4.0E-28
sp|Q4I1N3|MET3_GIBZE Sulfate adenylyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MET3 PE=3 SV=2 14 202 1.0E-27
sp|Q0V6P9|MET3_PHANO Sulfate adenylyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MET3 PE=3 SV=1 14 206 8.0E-27
sp|Q1EAF9|MET3_COCIM Sulfate adenylyltransferase OS=Coccidioides immitis (strain RS) GN=MET3 PE=3 SV=1 14 206 9.0E-27
sp|Q12555|MET3_EMENI Sulfate adenylyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=met3 PE=3 SV=1 14 206 2.0E-26
sp|P56862|MET3_ASPTE Sulfate adenylyltransferase OS=Aspergillus terreus GN=met3 PE=3 SV=1 14 204 2.0E-26
sp|A1CJC1|MET3_ASPCL Sulfate adenylyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=met3 PE=3 SV=1 14 202 2.0E-26
sp|Q0CC19|MET3_ASPTN Sulfate adenylyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=met3 PE=3 SV=1 14 204 3.0E-26
sp|Q2H454|MET3_CHAGB Sulfate adenylyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MET3 PE=3 SV=1 14 202 3.0E-26
sp|Q12650|MET3_PENCH Sulfate adenylyltransferase OS=Penicillium chrysogenum GN=met3 PE=1 SV=1 14 206 4.0E-26
sp|Q7SE75|MET3_NEUCR Sulfate adenylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met3 PE=3 SV=1 14 202 4.0E-26
sp|Q4P460|MET3_USTMA Sulfate adenylyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MET3 PE=3 SV=1 12 198 5.0E-25
sp|Q6CFD2|MET3_YARLI Sulfate adenylyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MET3 PE=3 SV=1 14 202 8.0E-25
sp|Q8J0I4|MET3_MUCCL Sulfate adenylyltransferase OS=Mucor circinelloides f. lusitanicus GN=MET3 PE=3 SV=1 14 204 4.0E-24
sp|P0CN04|MET3_CRYNJ Sulfate adenylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MET3 PE=3 SV=1 14 198 2.0E-20
sp|P0CN05|MET3_CRYNB Sulfate adenylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MET3 PE=3 SV=1 14 198 2.0E-20
sp|Q8TG24|MET3_CRYNH Sulfate adenylyltransferase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=MET3 PE=2 SV=1 14 198 1.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10465
MATNITWHPGLTRRERNQLRRQRGLTIWLTGLSASGKSTVAAALEQHLLHLGYAAYRLDGDNVRFGLNKDLGFSE
KDRNENIRRISEVAKLFADSSTIAITSFISPYRADRDLARQLHAASSAADDDSIPFVEVFVDVPLEVAEQRDPKG
LYKKARAGEIKDFTGISAPYEEPADAEITIKTHESSVEECVAQITRWLADKGHIKQG*
Coding >Hirsu2|10465
ATGGCGACCAACATCACCTGGCACCCGGGCCTCACCCGCCGCGAGCGCAACCAGCTCCGGCGCCAGCGCGGCCTC
ACCATCTGGCTCACCGGCCTGTCGGCGTCGGGCAAGTCGACCGTCGCCGCCGCCCTGGAGCAGCACCTGCTGCAC
CTCGGCTACGCCGCCTACCGCCTCGACGGCGACAACGTCCGCTTCGGCCTCAACAAGGACCTCGGCTTCTCCGAG
AAGGACCGCAATGAGAACATACGCCGTATCTCCGAGGTCGCCAAGCTCTTCGCCGACTCGTCCACGATTGCCATC
ACCTCCTTCATCTCGCCCTACCGCGCGGACCGCGACCTCGCCCGGCAGCTGCACGCGGCATCCTCCGCCGCCGAC
GACGACTCCATCCCCTTCGTCGAGGTCTTCGTCGACGTCCCCCTCGAGGTCGCCGAGCAGCGCGACCCCAAGGGC
CTCTACAAGAAGGCCCGCGCCGGCGAGATCAAGGACTTCACCGGCATCTCCGCCCCGTACGAGGAGCCCGCCGAC
GCCGAAATCACCATCAAGACGCACGAGAGCTCTGTCGAGGAGTGCGTCGCCCAAATAACCCGCTGGCTCGCCGAC
AAGGGCCACATAAAGCAGGGCTAG
Transcript >Hirsu2|10465
ATGGCGACCAACATCACCTGGCACCCGGGCCTCACCCGCCGCGAGCGCAACCAGCTCCGGCGCCAGCGCGGCCTC
ACCATCTGGCTCACCGGCCTGTCGGCGTCGGGCAAGTCGACCGTCGCCGCCGCCCTGGAGCAGCACCTGCTGCAC
CTCGGCTACGCCGCCTACCGCCTCGACGGCGACAACGTCCGCTTCGGCCTCAACAAGGACCTCGGCTTCTCCGAG
AAGGACCGCAATGAGAACATACGCCGTATCTCCGAGGTCGCCAAGCTCTTCGCCGACTCGTCCACGATTGCCATC
ACCTCCTTCATCTCGCCCTACCGCGCGGACCGCGACCTCGCCCGGCAGCTGCACGCGGCATCCTCCGCCGCCGAC
GACGACTCCATCCCCTTCGTCGAGGTCTTCGTCGACGTCCCCCTCGAGGTCGCCGAGCAGCGCGACCCCAAGGGC
CTCTACAAGAAGGCCCGCGCCGGCGAGATCAAGGACTTCACCGGCATCTCCGCCCCGTACGAGGAGCCCGCCGAC
GCCGAAATCACCATCAAGACGCACGAGAGCTCTGTCGAGGAGTGCGTCGCCCAAATAACCCGCTGGCTCGCCGAC
AAGGGCCACATAAAGCAGGGCTAG
Gene >Hirsu2|10465
ATGGCGACGTACGTGCTGCGCTGTCTCGCTCGTCTTTCACGGCCTTGATTTTCCGCTCCCTTCTCCCGATTCGAT
CGTCAGGTCCCCCCACGTCCTCGGCCCTGACCGGCGGCCGCGGCAGCCCTGCTCCCCCCGCCCGGTCACGGCCCT
TTCCTCGTCCTCCTGTGGCAATCTCCGAGTCTCCGGAAGAACATGCATACACATATACATGTATACATACGTGTT
GGGGGAGAGGGGGGCTTGGTCCCGATGGGCAGACGTACATGCCATCGTGAGGGGGAGCCGCTGACGGCATCGTGG
CAGCAACATCACCTGGCACCCGGGCCTCACCCGCCGCGAGCGCAACCAGCTCCGGCGCCAGCGCGGCCTCACCAT
CTGGCTCACCGGCCTGTCGGCGTCGGGCAAGTCGACCGTCGCCGCCGCCCTGGAGCAGCACCTGCTGCACCTCGG
CTACGCCGCCTACCGCCTCGACGGCGACAACGTCCGCTTCGGCCTCAACAAGGACCTCGGCTTCTCCGAGAAGGA
CCGCAATGAGAACATACGCCGTATCTCCGAGGTGAGAGCTCGCTCGGTCCTTGCAACGAGCCGTGTTACTTACCG
AGCCGTCGAACGCGGCACCCGTGTCCGTGTCCAGGTCGCCAAGCTCTTCGCCGACTCGTCCACGATTGCCATCAC
CTCCTTCATCTCGCCCTACCGCGCGGACCGCGACCTCGCCCGGCAGCTGCACGCGGCATCCTCCGCCGCCGACGA
CGACTCCATCCCCTTCGTCGAGGTCTTCGTCGACGTCCCCCTCGAGGTCGCCGAGCAGCGCGACCCCAAGGGCCT
CTACAAGAAGGCCCGCGCCGGCGAGATCAAGGACTTCACCGGCATCTCCGCCCCGTACGAGGAGCCCGCCGACGC
CGAAATCACCATCAAGACGCACGAGAGCTCTGTCGAGGAGTGCGTCGCCCAAATAACCCGCTGGCTCGCCGACAA
GGGCCACATAAAGCAGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail