Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10451
Gene name
LocationContig_847:5789..7981
Strand+
Gene length (bp)2192
Transcript length (bp)2058
Coding sequence length (bp)2058
Protein length (aa) 686

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 5.1E-267 50 650
PF06723 MreB_Mbl MreB/Mbl protein 7.4E-13 178 418
PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain 2.2E-04 367 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 1 668 0.0E+00
sp|P0CS90|HSP77_YEAST Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSC1 PE=1 SV=1 23 675 0.0E+00
sp|P0CS91|HSP77_YEASX Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1 23 652 0.0E+00
sp|P22774|HSP7M_SCHPO Heat shock 70 kDa protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=2 SV=2 1 659 0.0E+00
sp|P83784|HSP77_CANAL Heat shock protein SSC1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSC1 PE=1 SV=2 32 669 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 1 668 0.0E+00
sp|P0CS90|HSP77_YEAST Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSC1 PE=1 SV=1 23 675 0.0E+00
sp|P0CS91|HSP77_YEASX Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1 23 652 0.0E+00
sp|P22774|HSP7M_SCHPO Heat shock 70 kDa protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=2 SV=2 1 659 0.0E+00
sp|P83784|HSP77_CANAL Heat shock protein SSC1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSC1 PE=1 SV=2 32 669 0.0E+00
sp|P39987|HSP7E_YEAST Heat shock protein SSC3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM10 PE=3 SV=1 22 652 0.0E+00
sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1 46 676 0.0E+00
sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1 31 676 0.0E+00
sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2 46 676 0.0E+00
sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1 46 676 0.0E+00
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 31 676 0.0E+00
sp|Q5ZM98|GRP75_CHICK Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1 7 652 0.0E+00
sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus norvegicus GN=Hspa9 PE=1 SV=3 29 676 0.0E+00
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 12 679 0.0E+00
sp|P29845|HSP7E_DROME Heat shock 70 kDa protein cognate 5 OS=Drosophila melanogaster GN=Hsc70-5 PE=1 SV=2 44 679 0.0E+00
sp|P42374|DNAK_RHIME Chaperone protein DnaK OS=Rhizobium meliloti (strain 1021) GN=dnaK PE=3 SV=2 50 681 0.0E+00
sp|A6UEY0|DNAK_SINMW Chaperone protein DnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=3 SV=1 50 681 0.0E+00
sp|Q3SW76|DNAK_NITWN Chaperone protein DnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|B3Q972|DNAK_RHOPT Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|Q6NCY4|DNAK_RHOPA Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|O05700|DNAK_RHOS7 Chaperone protein DnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 50 677 0.0E+00
sp|Q2J320|DNAK_RHOP2 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|Q13E60|DNAK_RHOPS Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB5) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|Q98DD1|DNAK_RHILO Chaperone protein DnaK OS=Rhizobium loti (strain MAFF303099) GN=dnaK PE=3 SV=1 50 653 0.0E+00
sp|B8EIP9|DNAK_METSB Chaperone protein DnaK OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dnaK PE=3 SV=1 50 677 0.0E+00
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 50 681 0.0E+00
sp|A7IC65|DNAK_XANP2 Chaperone protein DnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=3 SV=1 50 660 0.0E+00
sp|Q1QRU1|DNAK_NITHX Chaperone protein DnaK OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|B1ZGR1|DNAK_METPB Chaperone protein DnaK OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|Q07US6|DNAK_RHOP5 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisA53) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|Q4FNP9|DNAK_PELUB Chaperone protein DnaK OS=Pelagibacter ubique (strain HTCC1062) GN=dnaK PE=3 SV=1 50 679 0.0E+00
sp|P94317|DNAK_BRADU Chaperone protein DnaK OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|A9W6R7|DNAK_METEP Chaperone protein DnaK OS=Methylobacterium extorquens (strain PA1) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|B6JCI3|DNAK_OLICO Chaperone protein DnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=3 SV=1 48 665 0.0E+00
sp|B7KSZ4|DNAK_METC4 Chaperone protein DnaK OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 50 672 0.0E+00
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 50 681 0.0E+00
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 50 653 0.0E+00
sp|Q21CI2|DNAK_RHOPB Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|B3PXH3|DNAK_RHIE6 Chaperone protein DnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|Q1MN11|DNAK_RHIL3 Chaperone protein DnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 50 666 0.0E+00
sp|B6IVA4|DNAK_RHOCS Chaperone protein DnaK OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaK PE=3 SV=1 50 673 0.0E+00
sp|Q2KDW6|DNAK_RHIEC Chaperone protein DnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 50 651 0.0E+00
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 50 651 0.0E+00
sp|Q2RNE6|DNAK_RHORT Chaperone protein DnaK OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|B5ZWQ2|DNAK_RHILW Chaperone protein DnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|B1LZ51|DNAK_METRJ Chaperone protein DnaK OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|A8GR22|DNAK_RICRS Chaperone protein DnaK OS=Rickettsia rickettsii (strain Sheila Smith) GN=dnaK PE=3 SV=1 48 657 0.0E+00
sp|B0BWH1|DNAK_RICRO Chaperone protein DnaK OS=Rickettsia rickettsii (strain Iowa) GN=dnaK PE=3 SV=1 48 657 0.0E+00
sp|B8IHL3|DNAK_METNO Chaperone protein DnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=3 SV=1 48 679 0.0E+00
sp|Q5NPS6|DNAK_ZYMMO Chaperone protein DnaK OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 50 657 0.0E+00
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 50 653 0.0E+00
sp|C3PMM7|DNAK_RICAE Chaperone protein DnaK OS=Rickettsia africae (strain ESF-5) GN=dnaK PE=3 SV=1 48 657 0.0E+00
sp|Q2VYT1|DNAK_MAGSA Chaperone protein DnaK OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A1ANV0|DNAK_PELPD Chaperone protein DnaK OS=Pelobacter propionicus (strain DSM 2379) GN=dnaK PE=3 SV=1 50 679 0.0E+00
sp|B2IBR4|DNAK_BEII9 Chaperone protein DnaK OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|Q1RHH0|DNAK_RICBR Chaperone protein DnaK OS=Rickettsia bellii (strain RML369-C) GN=dnaK PE=3 SV=1 48 675 0.0E+00
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 50 681 0.0E+00
sp|B0UR84|DNAK_METS4 Chaperone protein DnaK OS=Methylobacterium sp. (strain 4-46) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 50 678 0.0E+00
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 50 652 0.0E+00
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|Q68XI2|DNAK_RICTY Chaperone protein DnaK OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dnaK PE=3 SV=1 48 657 0.0E+00
sp|Q4UJK7|DNAK_RICFE Chaperone protein DnaK OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dnaK PE=3 SV=2 48 657 0.0E+00
sp|C6E643|DNAK_GEOSM Chaperone protein DnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=3 SV=1 50 674 0.0E+00
sp|Q01899|HSP7M_PHAVU Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1 50 635 0.0E+00
sp|C4K110|DNAK_RICPU Chaperone protein DnaK OS=Rickettsia peacockii (strain Rustic) GN=dnaK PE=3 SV=1 48 657 0.0E+00
sp|A9HEA3|DNAK_GLUDA Chaperone protein DnaK OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaK PE=3 SV=1 50 598 0.0E+00
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 50 652 0.0E+00
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 50 666 0.0E+00
sp|C0R3W7|DNAK_WOLWR Chaperone protein DnaK OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=dnaK PE=3 SV=1 48 684 0.0E+00
sp|Q9ZDX9|DNAK_RICPR Chaperone protein DnaK OS=Rickettsia prowazekii (strain Madrid E) GN=dnaK PE=3 SV=1 48 659 0.0E+00
sp|Q73GL7|DNAK_WOLPM Chaperone protein DnaK OS=Wolbachia pipientis wMel GN=dnaK PE=3 SV=1 48 684 0.0E+00
sp|A8GMF9|DNAK_RICAH Chaperone protein DnaK OS=Rickettsia akari (strain Hartford) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|B3CNB5|DNAK_WOLPP Chaperone protein DnaK OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|A0L4Z2|DNAK_MAGMM Chaperone protein DnaK OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 50 678 0.0E+00
sp|Q5FSL5|DNAK_GLUOX Chaperone protein DnaK OS=Gluconobacter oxydans (strain 621H) GN=dnaK PE=3 SV=1 50 602 0.0E+00
sp|Q5LWJ6|DNAK_RUEPO Chaperone protein DnaK OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaK PE=3 SV=1 48 659 0.0E+00
sp|P37900|HSP7M_PEA Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1 50 618 0.0E+00
sp|Q92J36|DNAK_RICCN Chaperone protein DnaK OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dnaK PE=3 SV=1 48 657 0.0E+00
sp|Q9LDZ0|HSP7J_ARATH Heat shock 70 kDa protein 10, mitochondrial OS=Arabidopsis thaliana GN=HSP70-10 PE=2 SV=1 50 614 0.0E+00
sp|P20442|DNAK_CAUCR Chaperone protein DnaK OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaK PE=2 SV=2 50 660 0.0E+00
sp|A5FZ19|DNAK_ACICJ Chaperone protein DnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=3 SV=1 50 682 0.0E+00
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 50 662 0.0E+00
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 50 678 0.0E+00
sp|B9M357|DNAK_GEODF Chaperone protein DnaK OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|O33528|DNAK_RHILE Chaperone protein DnaK OS=Rhizobium leguminosarum GN=dnaK PE=3 SV=1 50 663 0.0E+00
sp|Q1GKS3|DNAK_RUEST Chaperone protein DnaK OS=Ruegeria sp. (strain TM1040) GN=dnaK PE=3 SV=1 50 615 0.0E+00
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 48 617 0.0E+00
sp|A4WW89|DNAK_RHOS5 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=3 SV=1 50 660 0.0E+00
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|Q21X09|DNAK_RHOFT Chaperone protein DnaK OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 50 662 0.0E+00
sp|Q0K757|DNAK_CUPNH Chaperone protein DnaK OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|A3PNM1|DNAK_RHOS1 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=3 SV=1 50 653 0.0E+00
sp|Q3IYM7|DNAK_RHOS4 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=3 SV=1 50 653 0.0E+00
sp|B3R6G7|DNAK_CUPTR Chaperone protein DnaK OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q5GSE1|DNAK_WOLTR Chaperone protein DnaK OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|Q52701|DNAK_RHOCA Chaperone protein DnaK OS=Rhodobacter capsulatus GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 48 684 0.0E+00
sp|B8FGS3|DNAK_DESAA Chaperone protein DnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|Q5FFM4|DNAK_EHRRG Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Gardel) GN=dnaK PE=3 SV=1 49 677 0.0E+00
sp|Q0AKB1|DNAK_MARMM Chaperone protein DnaK OS=Maricaulis maris (strain MCS10) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|Q5HAY1|DNAK_EHRRW Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaK PE=3 SV=1 49 677 0.0E+00
sp|A1TLH9|DNAK_ACIAC Chaperone protein DnaK OS=Acidovorax citrulli (strain AAC00-1) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B1Y786|DNAK_LEPCP Chaperone protein DnaK OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q08276|HSP7M_SOLTU Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum GN=HSP68 PE=2 SV=1 50 614 0.0E+00
sp|Q46XI7|DNAK_CUPPJ Chaperone protein DnaK OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|A1WGJ9|DNAK_VEREI Chaperone protein DnaK OS=Verminephrobacter eiseniae (strain EF01-2) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q145F1|DNAK_BURXL Chaperone protein DnaK OS=Burkholderia xenovorans (strain LB400) GN=dnaK PE=3 SV=1 48 633 0.0E+00
sp|Q16D45|DNAK_ROSDO Chaperone protein DnaK OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaK PE=3 SV=1 50 659 0.0E+00
sp|O33522|DNAK_CUPMC Chaperone protein DnaK OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaK PE=3 SV=2 48 651 0.0E+00
sp|Q3YRR6|DNAK_EHRCJ Chaperone protein DnaK OS=Ehrlichia canis (strain Jake) GN=dnaK PE=3 SV=1 49 651 0.0E+00
sp|Q2G6N0|DNAK_NOVAD Chaperone protein DnaK OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dnaK PE=3 SV=1 50 599 0.0E+00
sp|A2SIR4|DNAK_METPP Chaperone protein DnaK OS=Methylibium petroleiphilum (strain PM1) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|C5CU12|DNAK_VARPS Chaperone protein DnaK OS=Variovorax paradoxus (strain S110) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|A1VMG2|DNAK_POLNA Chaperone protein DnaK OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B2UBP3|DNAK_RALPJ Chaperone protein DnaK OS=Ralstonia pickettii (strain 12J) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B2SXC6|DNAK_BURPP Chaperone protein DnaK OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaK PE=3 SV=1 48 633 0.0E+00
sp|A1WAR6|DNAK_ACISJ Chaperone protein DnaK OS=Acidovorax sp. (strain JS42) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B9MDJ7|DNAK_ACIET Chaperone protein DnaK OS=Acidovorax ebreus (strain TPSY) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q28VY3|DNAK_JANSC Chaperone protein DnaK OS=Jannaschia sp. (strain CCS1) GN=dnaK PE=3 SV=1 50 615 0.0E+00
sp|B2JGE2|DNAK_BURP8 Chaperone protein DnaK OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaK PE=3 SV=1 48 636 0.0E+00
sp|Q39JC8|DNAK_BURL3 Chaperone protein DnaK OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|C0QGP6|DNAK_DESAH Chaperone protein DnaK OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=dnaK PE=3 SV=1 48 663 0.0E+00
sp|B4EDZ2|DNAK_BURCJ Chaperone protein DnaK OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|A9BNG5|DNAK_DELAS Chaperone protein DnaK OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|A9AGB8|DNAK_BURM1 Chaperone protein DnaK OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B8GNX1|DNAK_THISH Chaperone protein DnaK OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|A0K4S8|DNAK_BURCH Chaperone protein DnaK OS=Burkholderia cenocepacia (strain HI2424) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B1JW19|DNAK_BURCC Chaperone protein DnaK OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q1BYX3|DNAK_BURCA Chaperone protein DnaK OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q8XW40|DNAK_RALSO Chaperone protein DnaK OS=Ralstonia solanacearum (strain GMI1000) GN=dnaK PE=3 SV=2 48 626 0.0E+00
sp|A4JBS1|DNAK_BURVG Chaperone protein DnaK OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|A8ZRW3|DNAK_DESOH Chaperone protein DnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=3 SV=1 51 665 0.0E+00
sp|Q2SYZ4|DNAK_BURTA Chaperone protein DnaK OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaK PE=3 SV=1 48 636 0.0E+00
sp|Q2KWA2|DNAK_BORA1 Chaperone protein DnaK OS=Bordetella avium (strain 197N) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|P20583|HSP71_TRYCR Heat shock 70 kDa protein, mitochondrial OS=Trypanosoma cruzi GN=MTP70 PE=3 SV=1 45 644 0.0E+00
sp|C4XQ63|DNAK_DESMR Chaperone protein DnaK OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q5PAB8|DNAK_ANAMM Chaperone protein DnaK OS=Anaplasma marginale (strain St. Maries) GN=dnaK PE=3 SV=1 50 657 0.0E+00
sp|O68191|DNAK_BURPS Chaperone protein DnaK OS=Burkholderia pseudomallei (strain K96243) GN=dnaK PE=3 SV=2 48 629 0.0E+00
sp|A3ND68|DNAK_BURP6 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 668) GN=dnaK PE=3 SV=1 48 629 0.0E+00
sp|A3NYX7|DNAK_BURP0 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1106a) GN=dnaK PE=3 SV=1 48 629 0.0E+00
sp|A1V0U6|DNAK_BURMS Chaperone protein DnaK OS=Burkholderia mallei (strain SAVP1) GN=dnaK PE=3 SV=1 48 629 0.0E+00
sp|Q62HD5|DNAK_BURMA Chaperone protein DnaK OS=Burkholderia mallei (strain ATCC 23344) GN=dnaK PE=3 SV=1 48 629 0.0E+00
sp|A2S565|DNAK_BURM9 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10229) GN=dnaK PE=3 SV=1 48 629 0.0E+00
sp|A3MN99|DNAK_BURM7 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10247) GN=dnaK PE=3 SV=1 48 629 0.0E+00
sp|Q0BI18|DNAK_BURCM Chaperone protein DnaK OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B1YTK0|DNAK_BURA4 Chaperone protein DnaK OS=Burkholderia ambifaria (strain MC40-6) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q3JP10|DNAK_BURP1 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1710b) GN=dnaK PE=3 SV=1 48 629 0.0E+00
sp|A6VCL8|DNAK_PSEA7 Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain PA7) GN=dnaK PE=3 SV=1 48 672 0.0E+00
sp|Q3J7D8|DNAK_NITOC Chaperone protein DnaK OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaK PE=3 SV=1 48 684 0.0E+00
sp|Q2NVZ1|DNAK_SODGM Chaperone protein DnaK OS=Sodalis glossinidius (strain morsitans) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|B4F2V5|DNAK_PROMH Chaperone protein DnaK OS=Proteus mirabilis (strain HI4320) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q5WV15|DNAK_LEGPL Chaperone protein DnaK OS=Legionella pneumophila (strain Lens) GN=dnaK PE=3 SV=1 50 678 0.0E+00
sp|Q7WGI4|DNAK_BORBR Chaperone protein DnaK OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|O32482|DNAK_LEGPN Chaperone protein DnaK OS=Legionella pneumophila GN=dnaK PE=3 SV=1 50 678 0.0E+00
sp|Q5ZTY3|DNAK_LEGPH Chaperone protein DnaK OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaK PE=3 SV=2 50 678 0.0E+00
sp|A5IDK8|DNAK_LEGPC Chaperone protein DnaK OS=Legionella pneumophila (strain Corby) GN=dnaK PE=3 SV=1 50 678 0.0E+00
sp|Q7VVY2|DNAK_BORPE Chaperone protein DnaK OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|Q9HV43|DNAK_PSEAE Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|Q02FR1|DNAK_PSEAB Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|Q2Y6U0|DNAK_NITMU Chaperone protein DnaK OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dnaK PE=3 SV=1 48 680 0.0E+00
sp|Q0BWZ9|DNAK_HYPNA Chaperone protein DnaK OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaK PE=3 SV=1 50 677 0.0E+00
sp|A9IGC3|DNAK_BORPD Chaperone protein DnaK OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|Q5X3M7|DNAK_LEGPA Chaperone protein DnaK OS=Legionella pneumophila (strain Paris) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|A6W2D2|DNAK_MARMS Chaperone protein DnaK OS=Marinomonas sp. (strain MWYL1) GN=dnaK PE=3 SV=1 48 670 0.0E+00
sp|Q7W519|DNAK_BORPA Chaperone protein DnaK OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|Q3Z601|DNAK_SHISS Chaperone protein DnaK OS=Shigella sonnei (strain Ss046) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q32KA5|DNAK_SHIDS Chaperone protein DnaK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q326K7|DNAK_SHIBS Chaperone protein DnaK OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q1RGI8|DNAK_ECOUT Chaperone protein DnaK OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|P0A6Y8|DNAK_ECOLI Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2 48 648 0.0E+00
sp|B1IRG0|DNAK_ECOLC Chaperone protein DnaK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|P0A6Y9|DNAK_ECOL6 Chaperone protein DnaK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaK PE=3 SV=2 48 648 0.0E+00
sp|Q0TLX5|DNAK_ECOL5 Chaperone protein DnaK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A1A766|DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A7ZVV7|DNAK_ECOHS Chaperone protein DnaK OS=Escherichia coli O9:H4 (strain HS) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|P0A6Z0|DNAK_ECO57 Chaperone protein DnaK OS=Escherichia coli O157:H7 GN=dnaK PE=3 SV=2 48 648 0.0E+00
sp|A7ZHA4|DNAK_ECO24 Chaperone protein DnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B7V1H3|DNAK_PSEA8 Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|A1JJD5|DNAK_YERE8 Chaperone protein DnaK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|Q313S2|DNAK_DESAG Chaperone protein DnaK OS=Desulfovibrio alaskensis (strain G20) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q8GUM2|HSP7I_ARATH Heat shock 70 kDa protein 9, mitochondrial OS=Arabidopsis thaliana GN=HSP70-9 PE=2 SV=1 50 618 0.0E+00
sp|Q0SMZ0|DNAK_BORAP Chaperone protein DnaK OS=Borrelia afzelii (strain PKo) GN=dnaK PE=3 SV=1 48 677 0.0E+00
sp|Q83MH5|DNAK_SHIFL Chaperone protein DnaK OS=Shigella flexneri GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q0T8H6|DNAK_SHIF8 Chaperone protein DnaK OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B7J282|DNAK_BORBZ Chaperone protein DnaK OS=Borrelia burgdorferi (strain ZS7) GN=dnaK PE=2 SV=1 48 676 0.0E+00
sp|P0C922|DNAK_BORBU Chaperone protein DnaK OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaK PE=2 SV=1 48 676 0.0E+00
sp|B1JL04|DNAK_YERPY Chaperone protein DnaK OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q66ET0|DNAK_YERPS Chaperone protein DnaK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A4TQF9|DNAK_YERPP Chaperone protein DnaK OS=Yersinia pestis (strain Pestoides F) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q1CMV7|DNAK_YERPN Chaperone protein DnaK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A9R015|DNAK_YERPG Chaperone protein DnaK OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q8ZIM7|DNAK_YERPE Chaperone protein DnaK OS=Yersinia pestis GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B2K3M0|DNAK_YERPB Chaperone protein DnaK OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q1C0J9|DNAK_YERPA Chaperone protein DnaK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A9MR77|DNAK_SALAR Chaperone protein DnaK OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q661A3|DNAK_BORBP Chaperone protein DnaK OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaK PE=3 SV=1 48 677 0.0E+00
sp|A1U614|DNAK_MARHV Chaperone protein DnaK OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|A4XYF6|DNAK_PSEMY Chaperone protein DnaK OS=Pseudomonas mendocina (strain ymp) GN=dnaK PE=3 SV=1 48 680 0.0E+00
sp|A5EYG3|DNAK_DICNV Chaperone protein DnaK OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaK PE=3 SV=1 48 660 0.0E+00
sp|Q128K2|DNAK_POLSJ Chaperone protein DnaK OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|Q7N8Y4|DNAK_PHOLL Chaperone protein DnaK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaK PE=3 SV=1 48 621 0.0E+00
sp|Q607A5|DNAK_METCA Chaperone protein DnaK OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|C6BSF2|DNAK_DESAD Chaperone protein DnaK OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaK PE=3 SV=1 50 663 0.0E+00
sp|Q87BS8|DNAK_XYLFT Chaperone protein DnaK OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dnaK PE=3 SV=1 48 617 0.0E+00
sp|B2I6F6|DNAK_XYLF2 Chaperone protein DnaK OS=Xylella fastidiosa (strain M23) GN=dnaK PE=3 SV=1 48 617 0.0E+00
sp|P57870|DNAK_PASMU Chaperone protein DnaK OS=Pasteurella multocida (strain Pm70) GN=dnaK PE=3 SV=1 48 647 0.0E+00
sp|B0U3J8|DNAK_XYLFM Chaperone protein DnaK OS=Xylella fastidiosa (strain M12) GN=dnaK PE=3 SV=1 48 617 0.0E+00
sp|Q8Z9R1|DNAK_SALTI Chaperone protein DnaK OS=Salmonella typhi GN=dnaK PE=3 SV=3 48 648 0.0E+00
sp|B4TVZ5|DNAK_SALSV Chaperone protein DnaK OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B5BLH8|DNAK_SALPK Chaperone protein DnaK OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q5PDJ5|DNAK_SALPA Chaperone protein DnaK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B4TIB4|DNAK_SALHS Chaperone protein DnaK OS=Salmonella heidelberg (strain SL476) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B5F6Y8|DNAK_SALA4 Chaperone protein DnaK OS=Salmonella agona (strain SL483) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A1K4C5|DNAK_AZOSB Chaperone protein DnaK OS=Azoarcus sp. (strain BH72) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|B5Y242|DNAK_KLEP3 Chaperone protein DnaK OS=Klebsiella pneumoniae (strain 342) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|O06430|DNAK_NITEU Chaperone protein DnaK OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaK PE=3 SV=1 50 602 0.0E+00
sp|A8ALU3|DNAK_CITK8 Chaperone protein DnaK OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|Q57TP3|DNAK_SALCH Chaperone protein DnaK OS=Salmonella choleraesuis (strain SC-B67) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q56073|DNAK_SALTY Chaperone protein DnaK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaK PE=3 SV=2 48 648 0.0E+00
sp|C0Q4F3|DNAK_SALPC Chaperone protein DnaK OS=Salmonella paratyphi C (strain RKS4594) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A9MXI2|DNAK_SALPB Chaperone protein DnaK OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B4T6D6|DNAK_SALNS Chaperone protein DnaK OS=Salmonella newport (strain SL254) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B5RF08|DNAK_SALG2 Chaperone protein DnaK OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B5FHA6|DNAK_SALDC Chaperone protein DnaK OS=Salmonella dublin (strain CT_02021853) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A7MIK5|DNAK_CROS8 Chaperone protein DnaK OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q8K9Y8|DNAK_BUCAP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaK PE=3 SV=1 48 679 0.0E+00
sp|A7FME3|DNAK_YERP3 Chaperone protein DnaK OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q47HK2|DNAK_DECAR Chaperone protein DnaK OS=Dechloromonas aromatica (strain RCB) GN=dnaK PE=3 SV=1 48 617 0.0E+00
sp|Q6AMQ3|DNAK_DESPS Chaperone protein DnaK OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaK PE=3 SV=1 48 614 0.0E+00
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 48 684 0.0E+00
sp|A4W6D5|DNAK_ENT38 Chaperone protein DnaK OS=Enterobacter sp. (strain 638) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|B5ENA3|DNAK_ACIF5 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaK PE=3 SV=1 50 594 0.0E+00
sp|B7J7X9|DNAK_ACIF2 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaK PE=3 SV=1 50 594 0.0E+00
sp|B5R5I2|DNAK_SALEP Chaperone protein DnaK OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|Q1H3B8|DNAK_METFK Chaperone protein DnaK OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|P71331|DNAK_AGGAC Chaperone protein DnaK OS=Aggregatibacter actinomycetemcomitans GN=dnaK PE=3 SV=3 48 664 0.0E+00
sp|C5B7L7|DNAK_EDWI9 Chaperone protein DnaK OS=Edwardsiella ictaluri (strain 93-146) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q9PB05|DNAK_XYLFA Chaperone protein DnaK OS=Xylella fastidiosa (strain 9a5c) GN=dnaK PE=3 SV=1 48 617 0.0E+00
sp|A6T4F4|DNAK_KLEP7 Chaperone protein DnaK OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|Q21H36|DNAK_SACD2 Chaperone protein DnaK OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaK PE=3 SV=1 48 597 0.0E+00
sp|B1XRU1|DNAK_POLNS Chaperone protein DnaK OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=dnaK PE=3 SV=1 48 620 0.0E+00
sp|P42373|DNAK_BURCE Chaperone protein DnaK OS=Burkholderia cepacia GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q8PMB0|DNAK_XANAC Chaperone protein DnaK OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|A4VPQ5|DNAK_PSEU5 Chaperone protein DnaK OS=Pseudomonas stutzeri (strain A1501) GN=dnaK PE=3 SV=1 48 672 0.0E+00
sp|Q7VQL4|DNAK_BLOFL Chaperone protein DnaK OS=Blochmannia floridanus GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|A6T226|DNAK_JANMA Chaperone protein DnaK OS=Janthinobacterium sp. (strain Marseille) GN=dnaK PE=3 SV=1 48 602 0.0E+00
sp|Q5H186|DNAK_XANOR Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|B2SQU4|DNAK_XANOP Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|Q2P459|DNAK_XANOM Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|A4SZR8|DNAK_POLSQ Chaperone protein DnaK OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|Q1LST3|DNAK_BAUCH Chaperone protein DnaK OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=dnaK PE=3 SV=1 48 665 0.0E+00
sp|A8G9K8|DNAK_SERP5 Chaperone protein DnaK OS=Serratia proteamaculans (strain 568) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q88DU2|DNAK_PSEPK Chaperone protein DnaK OS=Pseudomonas putida (strain KT2440) GN=dnaK PE=3 SV=1 48 677 0.0E+00
sp|Q5NFG7|DNAK_FRATT Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q14GW9|DNAK_FRAT1 Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|A1VFG6|DNAK_DESVV Chaperone protein DnaK OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|Q72DW8|DNAK_DESVH Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|Q3BVB8|DNAK_XANC5 Chaperone protein DnaK OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|Q65U55|DNAK_MANSM Chaperone protein DnaK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaK PE=3 SV=2 48 647 0.0E+00
sp|A0Q7F0|DNAK_FRATN Chaperone protein DnaK OS=Francisella tularensis subsp. novicida (strain U112) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|A6VNB1|DNAK_ACTSZ Chaperone protein DnaK OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaK PE=3 SV=1 48 617 0.0E+00
sp|Q0BLK4|DNAK_FRATO Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q2A328|DNAK_FRATH Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|A7NCM9|DNAK_FRATF Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|A4IX28|DNAK_FRATW Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q0AIY1|DNAK_NITEC Chaperone protein DnaK OS=Nitrosomonas eutropha (strain C91) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|C4K3I6|DNAK_HAMD5 Chaperone protein DnaK OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaK PE=3 SV=1 50 664 0.0E+00
sp|A4G8D2|DNAK_HERAR Chaperone protein DnaK OS=Herminiimonas arsenicoxydans GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B2VGR9|DNAK_ERWT9 Chaperone protein DnaK OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|Q2SMM8|DNAK_HAHCH Chaperone protein DnaK OS=Hahella chejuensis (strain KCTC 2396) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|B2S0M0|DNAK_BORHD Chaperone protein DnaK OS=Borrelia hermsii (strain HS1 / DAH) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|Q3SIN4|DNAK_THIDA Chaperone protein DnaK OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaK PE=3 SV=1 48 671 0.0E+00
sp|Q01PM8|DNAK_SOLUE Chaperone protein DnaK OS=Solibacter usitatus (strain Ellin6076) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|P48205|DNAK_FRATU Chaperone protein DnaK OS=Francisella tularensis GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|P48209|DNAK_HAEDU Chaperone protein DnaK OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaK PE=3 SV=2 48 674 0.0E+00
sp|Q1IF59|DNAK_PSEE4 Chaperone protein DnaK OS=Pseudomonas entomophila (strain L48) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|Q3KIA0|DNAK_PSEPF Chaperone protein DnaK OS=Pseudomonas fluorescens (strain Pf0-1) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|Q15UD3|DNAK_PSEA6 Chaperone protein DnaK OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|A5W9A3|DNAK_PSEP1 Chaperone protein DnaK OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|O87712|DNAK_COXBU Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaK PE=1 SV=1 50 615 0.0E+00
sp|A9N8H2|DNAK_COXBR Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaK PE=3 SV=1 50 615 0.0E+00
sp|A9KG88|DNAK_COXBN Chaperone protein DnaK OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaK PE=3 SV=1 50 615 0.0E+00
sp|B6J7U7|DNAK_COXB1 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaK PE=3 SV=1 50 615 0.0E+00
sp|Q8PAK9|DNAK_XANCP Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|B0RVU2|DNAK_XANCB Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q4UT11|DNAK_XANC8 Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|B8DRD6|DNAK_DESVM Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaK PE=3 SV=1 48 646 0.0E+00
sp|B0UWR4|DNAK_HISS2 Chaperone protein DnaK OS=Histophilus somni (strain 2336) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|B2SGV8|DNAK_FRATM Chaperone protein DnaK OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|B6IZJ0|DNAK_COXB2 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaK PE=3 SV=1 50 615 0.0E+00
sp|Q0I3V2|DNAK_HAES1 Chaperone protein DnaK OS=Haemophilus somnus (strain 129Pt) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|A1STE4|DNAK_PSYIN Chaperone protein DnaK OS=Psychromonas ingrahamii (strain 37) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|B4S0U1|DNAK_ALTMD Chaperone protein DnaK OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=dnaK PE=3 SV=1 48 647 0.0E+00
sp|B5RPM1|DNAK_BORRA Chaperone protein DnaK OS=Borrelia recurrentis (strain A1) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|B2FMY5|DNAK_STRMK Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaK PE=3 SV=1 48 647 0.0E+00
sp|B0TYF2|DNAK_FRAP2 Chaperone protein DnaK OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|Q4KIH1|DNAK_PSEF5 Chaperone protein DnaK OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|B5RM75|DNAK_BORDL Chaperone protein DnaK OS=Borrelia duttonii (strain Ly) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|Q2GF34|DNAK_NEOSM Chaperone protein DnaK OS=Neorickettsia sennetsu (strain Miyayama) GN=dnaK PE=3 SV=1 51 681 0.0E+00
sp|A4SQ25|DNAK_AERS4 Chaperone protein DnaK OS=Aeromonas salmonicida (strain A449) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|O85282|DNAK_NEOSE Chaperone protein DnaK OS=Neorickettsia sennetsu GN=dnaK PE=3 SV=1 51 681 0.0E+00
sp|B1J254|DNAK_PSEPW Chaperone protein DnaK OS=Pseudomonas putida (strain W619) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B4SSQ6|DNAK_STRM5 Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|C1DD88|DNAK_LARHH Chaperone protein DnaK OS=Laribacter hongkongensis (strain HLHK9) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|B8D758|DNAK_BUCAT Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaK PE=3 SV=1 48 599 0.0E+00
sp|O32464|DNAK_BUCAI Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaK PE=3 SV=1 48 599 0.0E+00
sp|B8D8V4|DNAK_BUCA5 Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaK PE=3 SV=1 48 599 0.0E+00
sp|C3LTA5|DNAK_VIBCM Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|O34241|DNAK_VIBCH Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaK PE=3 SV=2 48 605 0.0E+00
sp|A5F361|DNAK_VIBC3 Chaperone protein DnaK OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|Q1QSX0|DNAK_CHRSD Chaperone protein DnaK OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaK PE=3 SV=1 48 680 0.0E+00
sp|Q8I0H7|HSP7M_DICDI Heat shock 70 kDa protein, mitochondrial OS=Dictyostelium discoideum GN=mhsp70 PE=1 SV=1 43 654 0.0E+00
sp|B8F7S6|DNAK_HAEPS Chaperone protein DnaK OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q3IC08|DNAK_PSEHT Chaperone protein DnaK OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaK PE=3 SV=1 48 674 0.0E+00
sp|Q9ZFC6|DNAK_METSS Chaperone protein DnaK OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaK PE=3 SV=1 50 672 0.0E+00
sp|B3PF33|DNAK_CELJU Chaperone protein DnaK OS=Cellvibrio japonicus (strain Ueda107) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|P95334|DNAK_MYXXD Chaperone protein DnaK OS=Myxococcus xanthus (strain DK 1622) GN=dnaK PE=3 SV=2 48 651 0.0E+00
sp|C6DF10|DNAK_PECCP Chaperone protein DnaK OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaK PE=3 SV=1 48 604 0.0E+00
sp|B0KIS5|DNAK_PSEPG Chaperone protein DnaK OS=Pseudomonas putida (strain GB-1) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|Q6MNF8|DNAK_BDEBA Chaperone protein DnaK OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|Q7MN85|DNAK_VIBVY Chaperone protein DnaK OS=Vibrio vulnificus (strain YJ016) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|Q8DF66|DNAK_VIBVU Chaperone protein DnaK OS=Vibrio vulnificus (strain CMCP6) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|Q6D0B7|DNAK_PECAS Chaperone protein DnaK OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaK PE=3 SV=1 48 604 0.0E+00
sp|Q0VST6|DNAK_ALCBS Chaperone protein DnaK OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|C4L8Y5|DNAK_TOLAT Chaperone protein DnaK OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|C5BQ33|DNAK_TERTT Chaperone protein DnaK OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaK PE=3 SV=1 48 597 0.0E+00
sp|P12076|HSP71_LEIMA Heat shock 70-related protein 1, mitochondrial OS=Leishmania major GN=HSP70.1 PE=3 SV=3 32 661 0.0E+00
sp|A0KMI6|DNAK_AERHH Chaperone protein DnaK OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|Q87RX3|DNAK_VIBPA Chaperone protein DnaK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|A1KSG3|DNAK_NEIMF Chaperone protein DnaK OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaK PE=3 SV=1 50 606 0.0E+00
sp|Q4ZNP7|DNAK_PSEU2 Chaperone protein DnaK OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaK PE=3 SV=1 48 655 0.0E+00
sp|Q31HA7|DNAK_THICR Chaperone protein DnaK OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaK PE=3 SV=1 48 677 0.0E+00
sp|P59565|DNAK_BUCBP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaK PE=3 SV=1 50 649 0.0E+00
sp|B8J402|DNAK_DESDA Chaperone protein DnaK OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=dnaK PE=3 SV=1 50 646 0.0E+00
sp|A1AW22|DNAK_RUTMC Chaperone protein DnaK OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaK PE=3 SV=1 50 591 0.0E+00
sp|O52064|DNAK_MANHA Chaperone protein DnaK OS=Mannheimia haemolytica GN=dnaK PE=3 SV=1 48 684 0.0E+00
sp|Q87WP0|DNAK_PSESM Chaperone protein DnaK OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaK PE=3 SV=1 48 655 0.0E+00
sp|Q73Q16|DNAK_TREDE Chaperone protein DnaK OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaK PE=3 SV=1 48 671 0.0E+00
sp|Q0HLN0|DNAK_SHESM Chaperone protein DnaK OS=Shewanella sp. (strain MR-4) GN=dnaK PE=3 SV=1 48 670 0.0E+00
sp|Q0HY11|DNAK_SHESR Chaperone protein DnaK OS=Shewanella sp. (strain MR-7) GN=dnaK PE=3 SV=1 48 670 0.0E+00
sp|Q7NXI3|DNAK_CHRVO Chaperone protein DnaK OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|Q493S7|DNAK_BLOPB Chaperone protein DnaK OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaK PE=3 SV=1 48 624 0.0E+00
sp|Q48E62|DNAK_PSE14 Chaperone protein DnaK OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q9K0N4|DNAK_NEIMB Chaperone protein DnaK OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaK PE=1 SV=1 50 606 0.0E+00
sp|B2S2G4|DNAK_TREPS Chaperone protein DnaK OS=Treponema pallidum subsp. pallidum (strain SS14) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|O83246|DNAK_TREPA Chaperone protein DnaK OS=Treponema pallidum (strain Nichols) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|Q8D2Q5|DNAK_WIGBR Chaperone protein DnaK OS=Wigglesworthia glossinidia brevipalpis GN=dnaK PE=3 SV=1 46 587 0.0E+00
sp|Q5F6W5|DNAK_NEIG1 Chaperone protein DnaK OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaK PE=3 SV=1 50 606 0.0E+00
sp|Q9JVQ9|DNAK_NEIMA Chaperone protein DnaK OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaK PE=3 SV=1 50 606 0.0E+00
sp|A3M8W9|DNAK_ACIBT Chaperone protein DnaK OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaK PE=3 SV=2 50 680 0.0E+00
sp|B2HZZ7|DNAK_ACIBC Chaperone protein DnaK OS=Acinetobacter baumannii (strain ACICU) GN=dnaK PE=3 SV=1 50 680 0.0E+00
sp|Q12Q08|DNAK_SHEDO Chaperone protein DnaK OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaK PE=3 SV=1 48 673 0.0E+00
sp|Q6MB26|DNAK_PARUW Chaperone protein DnaK OS=Protochlamydia amoebophila (strain UWE25) GN=dnaK PE=3 SV=1 47 685 0.0E+00
sp|A0KTS5|DNAK_SHESA Chaperone protein DnaK OS=Shewanella sp. (strain ANA-3) GN=dnaK PE=3 SV=1 48 670 0.0E+00
sp|B7VJW9|DNAK_VIBTL Chaperone protein DnaK OS=Vibrio tasmaniensis (strain LGP32) GN=dnaK PE=3 SV=1 48 614 0.0E+00
sp|C3K275|DNAK_PSEFS Chaperone protein DnaK OS=Pseudomonas fluorescens (strain SBW25) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|A9M296|DNAK_NEIM0 Chaperone protein DnaK OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaK PE=3 SV=1 50 606 0.0E+00
sp|B0V5U4|DNAK_ACIBY Chaperone protein DnaK OS=Acinetobacter baumannii (strain AYE) GN=dnaK PE=3 SV=1 50 680 0.0E+00
sp|B7IBK5|DNAK_ACIB5 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB0057) GN=dnaK PE=3 SV=1 50 680 0.0E+00
sp|B7H317|DNAK_ACIB3 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaK PE=3 SV=1 50 680 0.0E+00
sp|Q824B2|DNAK_CHLCV Chaperone protein DnaK OS=Chlamydophila caviae (strain GPIC) GN=dnaK PE=3 SV=1 43 641 0.0E+00
sp|A1RGN1|DNAK_SHESW Chaperone protein DnaK OS=Shewanella sp. (strain W3-18-1) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|A4Y9Q3|DNAK_SHEPC Chaperone protein DnaK OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|A6WRU9|DNAK_SHEB8 Chaperone protein DnaK OS=Shewanella baltica (strain OS185) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|A3D7T4|DNAK_SHEB5 Chaperone protein DnaK OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|A9L0R8|DNAK_SHEB9 Chaperone protein DnaK OS=Shewanella baltica (strain OS195) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|Q8EHT7|DNAK_SHEON Chaperone protein DnaK OS=Shewanella oneidensis (strain MR-1) GN=dnaK PE=3 SV=1 48 670 0.0E+00
sp|Q9L7Z1|DNAK_VIBPR Chaperone protein DnaK OS=Vibrio proteolyticus GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|A5CX56|DNAK_VESOH Chaperone protein DnaK OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dnaK PE=3 SV=1 50 625 0.0E+00
sp|B3DZP7|DNAK_METI4 Chaperone protein DnaK OS=Methylacidiphilum infernorum (isolate V4) GN=dnaK PE=3 SV=1 50 617 0.0E+00
sp|Q086J3|DNAK_SHEFN Chaperone protein DnaK OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|A7MWW0|DNAK_VIBCB Chaperone protein DnaK OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|B8E4S1|DNAK_SHEB2 Chaperone protein DnaK OS=Shewanella baltica (strain OS223) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|Q5E3A7|DNAK2_VIBF1 Chaperone protein DnaK 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaK2 PE=3 SV=1 48 642 0.0E+00
sp|B5FA11|DNAK_VIBFM Chaperone protein DnaK OS=Vibrio fischeri (strain MJ11) GN=dnaK PE=3 SV=1 48 642 0.0E+00
sp|Q6F6N3|DNAK_ACIAD Chaperone protein DnaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaK PE=3 SV=1 50 672 0.0E+00
sp|Q6LS31|DNAK2_PHOPR Chaperone protein DnaK 2 OS=Photobacterium profundum GN=dnaK2 PE=3 SV=1 50 605 0.0E+00
sp|A5WI20|DNAK_PSYWF Chaperone protein DnaK OS=Psychrobacter sp. (strain PRwf-1) GN=dnaK PE=3 SV=1 51 651 0.0E+00
sp|Q6LUA7|DNAK1_PHOPR Chaperone protein DnaK 1 OS=Photobacterium profundum GN=dnaK1 PE=3 SV=1 48 615 0.0E+00
sp|Q253K1|DNAK_CHLFF Chaperone protein DnaK OS=Chlamydophila felis (strain Fe/C-56) GN=dnaK PE=3 SV=1 43 641 0.0E+00
sp|Q5QXL1|DNAK_IDILO Chaperone protein DnaK OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|Q5E4T4|DNAK1_VIBF1 Chaperone protein DnaK 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaK1 PE=3 SV=1 48 648 0.0E+00
sp|A1S8K7|DNAK_SHEAM Chaperone protein DnaK OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaK PE=3 SV=1 48 605 0.0E+00
sp|Q47XI6|DNAK2_COLP3 Chaperone protein DnaK 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaK2 PE=3 SV=1 48 666 0.0E+00
sp|B0BC31|DNAK_CHLTB Chaperone protein DnaK OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaK PE=3 SV=1 50 639 0.0E+00
sp|Q3KLV7|DNAK_CHLTA Chaperone protein DnaK OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaK PE=3 SV=1 50 639 0.0E+00
sp|B0B7W6|DNAK_CHLT2 Chaperone protein DnaK OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaK PE=3 SV=1 50 639 0.0E+00
sp|P17821|DNAK_CHLTR Chaperone protein DnaK OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaK PE=3 SV=4 50 639 0.0E+00
sp|P56836|DNAK_CHLMU Chaperone protein DnaK OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaK PE=3 SV=2 50 639 0.0E+00
sp|Q486F9|DNAK1_COLP3 Chaperone protein DnaK 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaK1 PE=3 SV=1 50 592 0.0E+00
sp|P27542|DNAK_CHLPN Chaperone protein DnaK OS=Chlamydia pneumoniae GN=dnaK PE=3 SV=1 43 641 0.0E+00
sp|Q1MPW1|DNAK_LAWIP Chaperone protein DnaK OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|A8FYU0|DNAK_SHESH Chaperone protein DnaK OS=Shewanella sediminis (strain HAW-EB3) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|Q1IT15|DNAK_KORVE Chaperone protein DnaK OS=Koribacter versatilis (strain Ellin345) GN=dnaK PE=3 SV=1 50 611 0.0E+00
sp|B0TQC2|DNAK_SHEHH Chaperone protein DnaK OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|B8CKF3|DNAK_SHEPW Chaperone protein DnaK OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaK PE=3 SV=1 48 669 0.0E+00
sp|Q1Q7X0|DNAK_PSYCK Chaperone protein DnaK OS=Psychrobacter cryohalolentis (strain K5) GN=dnaK PE=3 SV=1 48 679 0.0E+00
sp|A8H760|DNAK_SHEPA Chaperone protein DnaK OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaK PE=3 SV=1 48 648 0.0E+00
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 48 665 0.0E+00
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 48 680 0.0E+00
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 48 680 0.0E+00
sp|Q04Y47|DNAK_LEPBL Chaperone protein DnaK OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaK PE=3 SV=1 50 617 0.0E+00
sp|Q04VC8|DNAK_LEPBJ Chaperone protein DnaK OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaK PE=3 SV=1 50 617 0.0E+00
sp|Q8GH79|DNAK_CHLAB Chaperone protein DnaK OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaK PE=3 SV=2 43 641 0.0E+00
sp|B1KRT2|DNAK_SHEWM Chaperone protein DnaK OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|Q4FPS9|DNAK_PSYA2 Chaperone protein DnaK OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaK PE=3 SV=1 48 679 0.0E+00
sp|A3QGW2|DNAK_SHELP Chaperone protein DnaK OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q1AXX6|DNAK_RUBXD Chaperone protein DnaK OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=dnaK PE=3 SV=1 48 618 0.0E+00
sp|P61443|DNAK_LEPIN Chaperone protein DnaK OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaK PE=3 SV=1 50 617 0.0E+00
sp|P61442|DNAK_LEPIC Chaperone protein DnaK OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaK PE=3 SV=1 50 617 0.0E+00
sp|A5UF68|DNAK_HAEIG Chaperone protein DnaK OS=Haemophilus influenzae (strain PittGG) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|Q9XCB1|DNAK_RHOMR Chaperone protein DnaK OS=Rhodothermus marinus GN=dnaK PE=3 SV=1 48 684 0.0E+00
sp|A5UBQ1|DNAK_HAEIE Chaperone protein DnaK OS=Haemophilus influenzae (strain PittEE) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|C1F2D2|DNAK_ACIC5 Chaperone protein DnaK OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=dnaK PE=3 SV=1 50 605 0.0E+00
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|A5N6M2|DNAK_CLOK5 Chaperone protein DnaK OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaK PE=3 SV=1 50 679 0.0E+00
sp|B9E041|DNAK_CLOK1 Chaperone protein DnaK OS=Clostridium kluyveri (strain NBRC 12016) GN=dnaK PE=3 SV=1 50 679 0.0E+00
sp|A5FPU4|DNAK_DEHMB Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|P43736|DNAK_HAEIN Chaperone protein DnaK OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaK PE=3 SV=2 48 613 0.0E+00
sp|Q4QJW4|DNAK_HAEI8 Chaperone protein DnaK OS=Haemophilus influenzae (strain 86-028NP) GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|B2UKV6|DNAK_AKKM8 Chaperone protein DnaK OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=dnaK PE=3 SV=1 50 619 0.0E+00
sp|Q3ZYV1|DNAK_DEHMC Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain CBDB1) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|A3N3K0|DNAK_ACTP2 Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|O87384|DNAK_VIBHA Chaperone protein DnaK OS=Vibrio harveyi GN=dnaK PE=3 SV=1 48 613 0.0E+00
sp|B0BTI7|DNAK_ACTPJ Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|B4S6P7|DNAK_PROA2 Chaperone protein DnaK OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaK PE=3 SV=1 48 674 0.0E+00
sp|Q3Z6P1|DNAK_DEHM1 Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dnaK PE=3 SV=1 50 678 0.0E+00
sp|B3H2X7|DNAK_ACTP7 Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|Q8DI58|DNAK2_THEEB Chaperone protein dnaK2 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK2 PE=3 SV=1 50 614 0.0E+00
sp|Q05FS8|DNAK_CARRP Chaperone protein DnaK OS=Carsonella ruddii (strain PV) GN=dnaK PE=3 SV=1 50 649 0.0E+00
sp|Q3B577|DNAK_CHLL7 Chaperone protein DnaK OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaK PE=3 SV=1 48 678 0.0E+00
sp|A0Q1R4|DNAK_CLONN Chaperone protein DnaK OS=Clostridium novyi (strain NT) GN=dnaK PE=3 SV=1 48 680 0.0E+00
sp|A8Z5V5|DNAK_SULMW Chaperone protein DnaK OS=Sulcia muelleri (strain GWSS) GN=dnaK PE=3 SV=1 50 598 0.0E+00
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 50 652 0.0E+00
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 50 679 0.0E+00
sp|B3EKT9|DNAK_CHLPB Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain BS1) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|B4SDA0|DNAK_PELPB Chaperone protein DnaK OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dnaK PE=3 SV=1 48 680 0.0E+00
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|Q9WWG9|DNAK_PSESG Chaperone protein DnaK OS=Pseudomonas savastanoi pv. glycinea GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 48 651 0.0E+00
sp|Q45551|DNAK_GEOSE Chaperone protein DnaK OS=Geobacillus stearothermophilus GN=dnaK PE=3 SV=2 50 652 0.0E+00
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 50 652 0.0E+00
sp|P22358|DNAK2_SYNY3 Chaperone protein dnaK2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK2 PE=2 SV=1 48 652 0.0E+00
sp|A5FGL1|DNAK_FLAJ1 Chaperone protein DnaK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dnaK PE=3 SV=1 48 673 0.0E+00
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 48 671 0.0E+00
sp|B1ILM3|DNAK_CLOBK Chaperone protein DnaK OS=Clostridium botulinum (strain Okra / Type B1) GN=dnaK PE=3 SV=1 50 679 0.0E+00
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 50 675 0.0E+00
sp|B1I699|DNAK_DESAP Chaperone protein DnaK OS=Desulforudis audaxviator (strain MP104C) GN=dnaK PE=3 SV=1 50 615 0.0E+00
sp|Q9KWS7|DNAK_GEOTM Chaperone protein DnaK OS=Geobacillus thermoglucosidasius GN=dnaK PE=3 SV=3 50 679 0.0E+00
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 48 652 0.0E+00
sp|Q85FW4|DNAK_CYAME Chaperone protein dnaK OS=Cyanidioschyzon merolae GN=dnaK PE=3 SV=1 50 613 0.0E+00
sp|Q2RKX4|DNAK_MOOTA Chaperone protein DnaK OS=Moorella thermoacetica (strain ATCC 39073) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|B1KZN7|DNAK_CLOBM Chaperone protein DnaK OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dnaK PE=3 SV=1 50 679 0.0E+00
sp|B8I305|DNAK_CLOCE Chaperone protein DnaK OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaK PE=3 SV=1 50 679 0.0E+00
sp|P50021|DNAK2_SYNE7 Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2 50 618 0.0E+00
sp|A4SFB1|DNAK_CHLPM Chaperone protein DnaK OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|B3QZ38|DNAK_CHLT3 Chaperone protein DnaK OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=dnaK PE=3 SV=1 48 615 0.0E+00
sp|Q8YW74|DNAK2_NOSS1 Chaperone protein dnaK2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK2 PE=3 SV=1 50 641 0.0E+00
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|Q892R0|DNAK_CLOTE Chaperone protein DnaK OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaK PE=3 SV=1 50 652 0.0E+00
sp|A7GHH6|DNAK_CLOBL Chaperone protein DnaK OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|C1FVU0|DNAK_CLOBJ Chaperone protein DnaK OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|A5I640|DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|A7FXL5|DNAK_CLOB1 Chaperone protein DnaK OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|A4J7F3|DNAK_DESRM Chaperone protein DnaK OS=Desulfotomaculum reducens (strain MI-1) GN=dnaK PE=3 SV=1 48 647 0.0E+00
sp|Q7V9G2|DNAK2_PROMA Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK2 PE=3 SV=1 48 671 0.0E+00
sp|Q7UZG3|DNAK2_PROMP Chaperone protein dnaK2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaK2 PE=3 SV=1 48 619 0.0E+00
sp|Q7MA35|DNAK_WOLSU Chaperone protein DnaK OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaK PE=3 SV=1 48 663 0.0E+00
sp|Q3AF08|DNAK_CARHZ Chaperone protein DnaK OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaK PE=3 SV=1 48 681 0.0E+00
sp|B0SRF1|DNAK_LEPBP Chaperone protein DnaK OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|B0SHT1|DNAK_LEPBA Chaperone protein DnaK OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaK PE=3 SV=1 50 651 0.0E+00
sp|A6GXZ1|DNAK_FLAPJ Chaperone protein DnaK OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=dnaK PE=3 SV=1 48 680 0.0E+00
sp|Q2S307|DNAK_SALRD Chaperone protein DnaK OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaK PE=3 SV=1 48 631 0.0E+00
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 50 663 0.0E+00
sp|A2BZ91|DNAK_PROM5 Chaperone protein DnaK OS=Prochlorococcus marinus (strain MIT 9515) GN=dnaK PE=3 SV=1 48 619 0.0E+00
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 10 651 0.0E+00
sp|Q46I76|DNAK_PROMT Chaperone protein DnaK OS=Prochlorococcus marinus (strain NATL2A) GN=dnaK PE=3 SV=1 48 662 0.0E+00
sp|B9MJZ1|DNAK_CALBD Chaperone protein DnaK OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaK PE=3 SV=1 50 652 0.0E+00
sp|C0ZB48|DNAK_BREBN Chaperone protein DnaK OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaK PE=3 SV=1 50 604 0.0E+00
sp|Q9KD72|DNAK_BACHD Chaperone protein DnaK OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaK PE=3 SV=3 50 669 0.0E+00
sp|B3ERN8|DNAK_AMOA5 Chaperone protein DnaK OS=Amoebophilus asiaticus (strain 5a2) GN=dnaK PE=3 SV=1 48 598 0.0E+00
sp|P55994|DNAK_HELPY Chaperone protein DnaK OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaK PE=3 SV=2 48 662 0.0E+00
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 48 647 0.0E+00
sp|Q8DKR6|DNAK1_THEEB Chaperone protein dnaK1 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK1 PE=3 SV=1 48 652 0.0E+00
sp|B2URT8|DNAK_HELPS Chaperone protein DnaK OS=Helicobacter pylori (strain Shi470) GN=dnaK PE=3 SV=1 48 662 0.0E+00
sp|Q0SRE3|DNAK_CLOPS Chaperone protein DnaK OS=Clostridium perfringens (strain SM101 / Type A) GN=dnaK PE=3 SV=1 50 665 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0000902 cell morphogenesis Yes
GO:0016740 transferase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044238 primary metabolic process No
GO:0032502 developmental process No
GO:0032989 cellular component morphogenesis No
GO:0016043 cellular component organization No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0009653 anatomical structure morphogenesis No
GO:0048869 cellular developmental process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10451
MLASRFSRALPRATLFTARSTAFTRAPLVSRFARHESTAAEGEGKVQGAVIGIDLGTTNSAVSIMEGKTPRIIEN
SEGARTTPSVVAFAEDGERLVGVAAKRQAVVNPENTLFATKRLIGRKFTDAEVQRDIKEVPYKIVQHSNGDAWVE
ARGQKFSPSQIGGFVLNKMKETAEAYLSKPVKNAVVTVPAYFNDAQRQSTKDAGQIAGLNVLRVVNEPTAAALAY
GLEKSADSVVAVYDLGGGTFDISILEIQHGVFEVKSTNGDTHLGGEDFDIHLVRHIVADFKKTSGIDLSGDRMAI
QRIREAAEKAKIELSSSLQTDINLPFITADASGPKHINMKLSRAQLEKMVEPLIKRTTDPVRKALKDAGLTAKDI
KEVILVGGMTRMPKVAESVKDIFGRDPAKAVNPDEAVAMGAAIQGAVLAGEVKDLLLLDVTPLSLGIETLGGVFT
RLINRNTTIPTKKSQVFSTAADFQTAVEIKVYQGERELVRDNKMLGNFQLVGIPPAHRGQPQIEVTFDIDADSIV
HVHAKDKSTNKDQSITIASGSGLSESEIQQMVEDSEKYAESDKERKAAIEAANRADSLMNDTEDALTKHGDKLDK
AEVDSIKEKVASLREFVAKSQSGESDVPAAEIKEKTNELQRVTLNLFDKLHQARNQSNDGQQGEGEQQQSGESEK
KDENDKSNKP*
Coding >Hirsu2|10451
ATGTTGGCTTCGCGTTTCTCCCGAGCTCTTCCCCGGGCAACTCTCTTCACAGCCCGATCAACCGCCTTCACTCGG
GCGCCTCTGGTATCTAGATTCGCTCGCCATGAGTCCACAGCTGCCGAGGGCGAAGGCAAGGTGCAGGGCGCCGTC
ATTGGTATAGATCTGGGCACCACAAACTCTGCCGTCTCCATCATGGAAGGCAAGACGCCTCGCATCATCGAGAAC
TCAGAAGGTGCTCGTACCACCCCCTCAGTCGTTGCCTTTGCCGAGGACGGCGAGAGACTCGTCGGCGTCGCTGCC
AAGCGACAGGCCGTCGTCAACCCCGAGAACACTCTCTTCGCCACCAAGCGGTTAATAGGACGCAAGTTCACCGAC
GCCGAGGTGCAGAGAGACATCAAGGAGGTGCCTTATAAGATTGTCCAGCACAGCAACGGCGACGCTTGGGTCGAG
GCCCGGGGCCAGAAGTTCTCGCCCTCTCAAATCGGTGGCTTTGTTCTCAACAAGATGAAGGAGACTGCCGAGGCC
TACCTGTCCAAGCCCGTCAAGAATGCTGTCGTCACCGTCCCTGCCTACTTCAACGACGCCCAACGCCAGAGCACC
AAGGACGCTGGTCAAATCGCCGGTCTCAACGTTCTCCGCGTCGTCAACGAGCCTACTGCCGCCGCTCTCGCCTAT
GGACTGGAAAAGTCGGCTGACTCGGTCGTTGCCGTCTACGACCTTGGCGGTGGCACCTTCGACATCTCCATCCTC
GAGATCCAGCACGGCGTCTTCGAGGTCAAGTCCACCAACGGCGACACCCACCTGGGTGGAGAGGACTTTGACATT
CATCTCGTCCGACACATCGTCGCCGACTTCAAGAAGACGTCCGGCATCGATCTTTCCGGCGACCGCATGGCCATT
CAGCGCATCCGCGAGGCCGCCGAGAAGGCCAAGATCGAGCTGTCGTCGTCCCTGCAGACGGACATCAACCTGCCC
TTCATCACTGCCGACGCCTCTGGCCCCAAGCACATCAACATGAAGCTCAGCCGCGCCCAGCTGGAGAAGATGGTC
GAGCCCCTCATCAAGCGCACCACCGACCCCGTCCGCAAGGCCCTCAAGGATGCCGGCCTGACGGCCAAGGACATC
AAGGAGGTCATCCTGGTCGGTGGCATGACGCGCATGCCCAAGGTCGCCGAGTCCGTCAAAGACATCTTCGGCCGC
GACCCCGCCAAGGCGGTCAACCCTGACGAGGCCGTCGCCATGGGAGCCGCCATCCAGGGTGCCGTCCTCGCTGGC
GAGGTCAAGGATCTCCTGCTTCTCGACGTCACGCCCCTTTCGCTCGGTATCGAGACGCTGGGCGGCGTCTTCACG
CGTCTGATCAACCGCAACACGACGATCCCCACCAAGAAGTCGCAGGTCTTCTCGACTGCCGCCGATTTCCAGACG
GCCGTCGAGATCAAGGTGTACCAGGGCGAGCGCGAGCTGGTCCGGGACAACAAGATGCTCGGAAACTTCCAGCTC
GTCGGCATTCCTCCCGCCCATCGCGGCCAGCCTCAGATCGAGGTCACGTTCGACATCGACGCGGACTCGATCGTG
CACGTCCACGCCAAGGACAAGTCGACGAACAAGGACCAGTCCATCACCATCGCCTCGGGCTCGGGCCTCTCGGAG
AGCGAGATCCAGCAGATGGTGGAGGACTCGGAGAAGTACGCCGAGAGCGACAAGGAGCGCAAGGCGGCCATCGAG
GCTGCCAACCGCGCCGACAGCCTCATGAACGACACGGAGGACGCGCTGACCAAGCACGGCGACAAGCTCGACAAG
GCCGAGGTGGATTCGATCAAGGAGAAGGTTGCGTCGCTCCGCGAGTTCGTCGCCAAGAGCCAGTCGGGCGAGAGC
GACGTGCCGGCCGCCGAGATCAAGGAGAAGACGAACGAGCTCCAGAGGGTGACGCTGAACCTGTTCGACAAGCTG
CACCAGGCCCGGAACCAGAGCAACGACGGCCAGCAGGGCGAGGGCGAGCAGCAGCAGAGCGGCGAGAGCGAGAAG
AAGGACGAGAACGACAAGTCGAACAAGCCTTAA
Transcript >Hirsu2|10451
ATGTTGGCTTCGCGTTTCTCCCGAGCTCTTCCCCGGGCAACTCTCTTCACAGCCCGATCAACCGCCTTCACTCGG
GCGCCTCTGGTATCTAGATTCGCTCGCCATGAGTCCACAGCTGCCGAGGGCGAAGGCAAGGTGCAGGGCGCCGTC
ATTGGTATAGATCTGGGCACCACAAACTCTGCCGTCTCCATCATGGAAGGCAAGACGCCTCGCATCATCGAGAAC
TCAGAAGGTGCTCGTACCACCCCCTCAGTCGTTGCCTTTGCCGAGGACGGCGAGAGACTCGTCGGCGTCGCTGCC
AAGCGACAGGCCGTCGTCAACCCCGAGAACACTCTCTTCGCCACCAAGCGGTTAATAGGACGCAAGTTCACCGAC
GCCGAGGTGCAGAGAGACATCAAGGAGGTGCCTTATAAGATTGTCCAGCACAGCAACGGCGACGCTTGGGTCGAG
GCCCGGGGCCAGAAGTTCTCGCCCTCTCAAATCGGTGGCTTTGTTCTCAACAAGATGAAGGAGACTGCCGAGGCC
TACCTGTCCAAGCCCGTCAAGAATGCTGTCGTCACCGTCCCTGCCTACTTCAACGACGCCCAACGCCAGAGCACC
AAGGACGCTGGTCAAATCGCCGGTCTCAACGTTCTCCGCGTCGTCAACGAGCCTACTGCCGCCGCTCTCGCCTAT
GGACTGGAAAAGTCGGCTGACTCGGTCGTTGCCGTCTACGACCTTGGCGGTGGCACCTTCGACATCTCCATCCTC
GAGATCCAGCACGGCGTCTTCGAGGTCAAGTCCACCAACGGCGACACCCACCTGGGTGGAGAGGACTTTGACATT
CATCTCGTCCGACACATCGTCGCCGACTTCAAGAAGACGTCCGGCATCGATCTTTCCGGCGACCGCATGGCCATT
CAGCGCATCCGCGAGGCCGCCGAGAAGGCCAAGATCGAGCTGTCGTCGTCCCTGCAGACGGACATCAACCTGCCC
TTCATCACTGCCGACGCCTCTGGCCCCAAGCACATCAACATGAAGCTCAGCCGCGCCCAGCTGGAGAAGATGGTC
GAGCCCCTCATCAAGCGCACCACCGACCCCGTCCGCAAGGCCCTCAAGGATGCCGGCCTGACGGCCAAGGACATC
AAGGAGGTCATCCTGGTCGGTGGCATGACGCGCATGCCCAAGGTCGCCGAGTCCGTCAAAGACATCTTCGGCCGC
GACCCCGCCAAGGCGGTCAACCCTGACGAGGCCGTCGCCATGGGAGCCGCCATCCAGGGTGCCGTCCTCGCTGGC
GAGGTCAAGGATCTCCTGCTTCTCGACGTCACGCCCCTTTCGCTCGGTATCGAGACGCTGGGCGGCGTCTTCACG
CGTCTGATCAACCGCAACACGACGATCCCCACCAAGAAGTCGCAGGTCTTCTCGACTGCCGCCGATTTCCAGACG
GCCGTCGAGATCAAGGTGTACCAGGGCGAGCGCGAGCTGGTCCGGGACAACAAGATGCTCGGAAACTTCCAGCTC
GTCGGCATTCCTCCCGCCCATCGCGGCCAGCCTCAGATCGAGGTCACGTTCGACATCGACGCGGACTCGATCGTG
CACGTCCACGCCAAGGACAAGTCGACGAACAAGGACCAGTCCATCACCATCGCCTCGGGCTCGGGCCTCTCGGAG
AGCGAGATCCAGCAGATGGTGGAGGACTCGGAGAAGTACGCCGAGAGCGACAAGGAGCGCAAGGCGGCCATCGAG
GCTGCCAACCGCGCCGACAGCCTCATGAACGACACGGAGGACGCGCTGACCAAGCACGGCGACAAGCTCGACAAG
GCCGAGGTGGATTCGATCAAGGAGAAGGTTGCGTCGCTCCGCGAGTTCGTCGCCAAGAGCCAGTCGGGCGAGAGC
GACGTGCCGGCCGCCGAGATCAAGGAGAAGACGAACGAGCTCCAGAGGGTGACGCTGAACCTGTTCGACAAGCTG
CACCAGGCCCGGAACCAGAGCAACGACGGCCAGCAGGGCGAGGGCGAGCAGCAGCAGAGCGGCGAGAGCGAGAAG
AAGGACGAGAACGACAAGTCGAACAAGCCTTAA
Gene >Hirsu2|10451
ATGTTGGCTTCGCGTTTCTCCCGAGCTGTAAGCTATGCTTCCGAGGGTCTGCGTACTCCTGGTGCACGCTCCTAA
CACAAGGAATTTCTTGCCACAGCTTCCCCGGGCAACTCTCTTCACAGCCCGATCAACCGCCTTCACTCGGGCGCC
TCTGGTATCTAGATTCGCTCGCCATGAGTCCACAGCTGCCGAGGGCGAAGGCAAGGTGCAGGGCGCCGTCATTGG
TATAGATCTGGGCACCACAAACTCTGCCGTCTCCATCATGGAAGGCAAGACGCCTCGCATCATCGAGAACTCAGA
AGGTTGGTGGATTCCGCTCGCTCACCCCTGTCCCTCTAGACTTGCCGGCTAATAGGATACCTACAGGTGCTCGTA
CCACCCCCTCAGTCGTTGCCTTTGCCGAGGACGGCGAGAGACTCGTCGGCGTCGCTGCCAAGCGACAGGCCGTCG
TCAACCCCGAGAACACTCTCTTCGCCACCAAGCGGTTAATAGGACGCAAGTTCACCGACGCCGAGGTGCAGAGAG
ACATCAAGGAGGTGCCTTATAAGATTGTCCAGCACAGCAACGGCGACGCTTGGGTCGAGGCCCGGGGCCAGAAGT
TCTCGCCCTCTCAAATCGGTGGCTTTGTTCTCAACAAGATGAAGGAGACTGCCGAGGCCTACCTGTCCAAGCCCG
TCAAGAATGCTGTCGTCACCGTCCCTGCCTACTTCAACGACGCCCAACGCCAGAGCACCAAGGACGCTGGTCAAA
TCGCCGGTCTCAACGTTCTCCGCGTCGTCAACGAGCCTACTGCCGCCGCTCTCGCCTATGGACTGGAAAAGTCGG
CTGACTCGGTCGTTGCCGTCTACGACCTTGGCGGTGGCACCTTCGACATCTCCATCCTCGAGATCCAGCACGGCG
TCTTCGAGGTCAAGTCCACCAACGGCGACACCCACCTGGGTGGAGAGGACTTTGACATTCATCTCGTCCGACACA
TCGTCGCCGACTTCAAGAAGACGTCCGGCATCGATCTTTCCGGCGACCGCATGGCCATTCAGCGCATCCGCGAGG
CCGCCGAGAAGGCCAAGATCGAGCTGTCGTCGTCCCTGCAGACGGACATCAACCTGCCCTTCATCACTGCCGACG
CCTCTGGCCCCAAGCACATCAACATGAAGCTCAGCCGCGCCCAGCTGGAGAAGATGGTCGAGCCCCTCATCAAGC
GCACCACCGACCCCGTCCGCAAGGCCCTCAAGGATGCCGGCCTGACGGCCAAGGACATCAAGGAGGTCATCCTGG
TCGGTGGCATGACGCGCATGCCCAAGGTCGCCGAGTCCGTCAAAGACATCTTCGGCCGCGACCCCGCCAAGGCGG
TCAACCCTGACGAGGCCGTCGCCATGGGAGCCGCCATCCAGGGTGCCGTCCTCGCTGGCGAGGTCAAGGATCTCC
TGCTTCTCGACGTCACGCCCCTTTCGCTCGGTATCGAGACGCTGGGCGGCGTCTTCACGCGTCTGATCAACCGCA
ACACGACGATCCCCACCAAGAAGTCGCAGGTCTTCTCGACTGCCGCCGATTTCCAGACGGCCGTCGAGATCAAGG
TGTACCAGGGCGAGCGCGAGCTGGTCCGGGACAACAAGATGCTCGGAAACTTCCAGCTCGTCGGCATTCCTCCCG
CCCATCGCGGCCAGCCTCAGATCGAGGTCACGTTCGACATCGACGCGGACTCGATCGTGCACGTCCACGCCAAGG
ACAAGTCGACGAACAAGGACCAGTCCATCACCATCGCCTCGGGCTCGGGCCTCTCGGAGAGCGAGATCCAGCAGA
TGGTGGAGGACTCGGAGAAGTACGCCGAGAGCGACAAGGAGCGCAAGGCGGCCATCGAGGCTGCCAACCGCGCCG
ACAGCCTCATGAACGACACGGAGGACGCGCTGACCAAGCACGGCGACAAGCTCGACAAGGCCGAGGTGGATTCGA
TCAAGGAGAAGGTTGCGTCGCTCCGCGAGTTCGTCGCCAAGAGCCAGTCGGGCGAGAGCGACGTGCCGGCCGCCG
AGATCAAGGAGAAGACGAACGAGCTCCAGAGGGTGACGCTGAACCTGTTCGACAAGCTGCACCAGGCCCGGAACC
AGAGCAACGACGGCCAGCAGGGCGAGGGCGAGCAGCAGCAGAGCGGCGAGAGCGAGAAGAAGGACGAGAACGACA
AGTCGAACAAGCCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail