Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10449
Gene name
LocationContig_847:788..3147
Strand-
Gene length (bp)2359
Transcript length (bp)2019
Coding sequence length (bp)2019
Protein length (aa) 673

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10313 DUF2415 Uncharacterised protein domain (DUF2415) 1.2E-09 339 379

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87229|YC03_SCHPO Uncharacterized protein C4G3.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.03 PE=4 SV=1 181 370 2.0E-08
sp|Q99296|YL149_YEAST Uncharacterized protein YLR149C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR149C PE=1 SV=1 284 390 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10449
MAVNDDDLSFPTNSIVSKTARRHYRVPVRSQHWQLRSLISAEKRHLVYFPGGNGSNHVQRLNTLSHECETIKLLT
FAPRCLVAENGWLCCGSETGEFVAMNLDDGGEDTHAFMSTLDLETSRRHAGADSRREDPLLSLLAQARRSNKSLI
AKSVKLAKDRVNCVTLWFPPRLLSAVPEAYAEAVAVLANNDRTVVLVSLRDFEQSDKTEPLDVVTYPDFVNRAII
SPDGQFLIAILDDPYLYVHQRCERPADAPPPASGANSGWQWELKQRYMLKSQRRDDRTDSRGSFAACFSPSGAYL
AVGTQHGTISIFDAALLAKPAAEPLITTFKSSRPESGQGAVRDMAFCPGPFDILAWTEDRGHIGFADMRSNFVIR
QIVNINADVDFEHIDILDRNTIDPRLLNSHGERRSNRSPSSAVTRRRHGEGLETLNQPLTADETVVLEAIQGDRR
RRDRQRAAGNEDASRNADFSWTYLANLRASAGNDGDSQRPRERSSSVGRAMGDGLGSHRDQRERASERIRTARQL
VREAGEQRQLFRRPDQRLMDRIGETVAAMRDQTIAAINPRERPDSSYLNVLEMLQARERTPGETEHDDPSLLVPL
VNQAMNRWEESAIRGTLPADHGVFEVPPSPDNTAGLAWTADGRTLFVGAQNGIYELHINVHGRKLCPSITMR*
Coding >Hirsu2|10449
ATGGCCGTCAACGATGACGATCTGTCCTTCCCGACCAACAGCATCGTTTCCAAGACGGCGCGCAGACACTACCGC
GTCCCCGTTCGATCGCAGCACTGGCAGCTGCGCTCCCTCATCAGCGCAGAGAAGCGGCACCTCGTCTACTTCCCG
GGCGGCAACGGCAGCAATCATGTCCAGCGCCTCAACACACTGTCGCACGAATGCGAGACCATCAAGCTTCTGACC
TTTGCGCCCCGCTGCCTCGTTGCCGAGAACGGCTGGCTCTGCTGCGGCAGCGAGACGGGCGAGTTTGTGGCCATG
AACCTCGACGATGGCGGCGAAGATACCCATGCCTTCATGTCGACGCTCGACCTGGAAACGTCCCGACGCCACGCC
GGCGCCGACAGCCGGCGCGAAGACCCCCTCCTCTCCCTCCTGGCCCAGGCCCGCCGATCGAACAAGAGCTTGATA
GCCAAGAGCGTGAAGCTGGCCAAGGACCGCGTCAACTGCGTCACCCTCTGGTTCCCTCCACGACTCCTCTCCGCC
GTCCCGGAAGCCTACGCCGAGGCCGTCGCCGTGCTGGCCAACAACGACCGCACCGTCGTCCTCGTCAGCCTGCGC
GACTTCGAGCAGAGCGACAAGACGGAGCCCCTGGATGTCGTCACCTATCCTGACTTCGTCAACCGCGCCATCATC
TCGCCCGACGGCCAGTTTCTCATTGCCATCCTCGACGATCCATACCTCTACGTCCACCAGCGCTGCGAGCGGCCG
GCCGACGCGCCGCCTCCGGCCTCGGGCGCCAACAGCGGGTGGCAATGGGAGCTGAAGCAGAGGTACATGCTCAAG
AGCCAACGGAGGGACGACCGGACCGACAGCCGCGGCAGCTTCGCCGCCTGCTTCTCCCCCTCTGGCGCCTACCTG
GCCGTCGGAACCCAGCACGGCACCATCTCGATATTCGATGCGGCGCTGCTGGCCAAGCCGGCCGCCGAGCCCCTC
ATCACCACCTTCAAGTCGTCGCGCCCGGAAAGTGGCCAGGGAGCCGTCCGAGACATGGCCTTCTGCCCCGGTCCT
TTCGACATCCTGGCGTGGACGGAGGACCGCGGACACATTGGCTTTGCCGACATGCGGAGTAACTTCGTCATCCGC
CAGATCGTCAACATCAACGCCGACGTCGACTTCGAGCACATCGACATCCTGGACCGAAACACCATCGACCCTCGG
CTGTTGAACAGCCACGGCGAACGGCGAAGCAACCGGTCACCCTCGTCGGCGGTGACTCGCAGGCGGCACGGGGAG
GGACTCGAAACGCTGAACCAGCCCCTGACGGCCGACGAGACGGTCGTTCTCGAGGCCATTCAAGGAGACAGGAGG
CGGCGCGACCGTCAGAGGGCGGCAGGCAACGAGGACGCGTCCAGGAACGCGGATTTCTCGTGGACCTACCTGGCC
AACCTTCGAGCGTCTGCCGGCAATGACGGGGACTCTCAGCGGCCGCGAGAGCGAAGCAGCAGCGTCGGCCGGGCC
ATGGGAGACGGGCTGGGGTCGCATCGTGACCAGCGCGAGCGCGCATCGGAGCGCATCCGCACCGCGCGCCAGCTG
GTGCGCGAGGCTGGCGAGCAGCGGCAGCTGTTCCGCCGGCCGGACCAGCGGCTGATGGACCGGATCGGCGAGACG
GTCGCGGCCATGAGGGATCAAACGATCGCGGCCATAAACCCGCGCGAGAGGCCCGACTCGTCGTACCTCAACGTG
CTCGAAATGCTGCAGGCCAGGGAGCGCACGCCGGGCGAGACGGAGCACGACGACCCGTCGTTGCTTGTGCCGCTG
GTCAACCAGGCCATGAACCGGTGGGAGGAGAGCGCGATCCGCGGCACGCTGCCGGCCGACCACGGCGTCTTTGAG
GTGCCACCCTCGCCCGATAACACCGCCGGGTTGGCGTGGACTGCCGACGGTCGCACCCTGTTTGTCGGGGCCCAA
AACGGCATATACGAGCTACACATCAACGTCCACGGCAGGAAGCTTTGCCCCAGTATCACGATGCGCTGA
Transcript >Hirsu2|10449
ATGGCCGTCAACGATGACGATCTGTCCTTCCCGACCAACAGCATCGTTTCCAAGACGGCGCGCAGACACTACCGC
GTCCCCGTTCGATCGCAGCACTGGCAGCTGCGCTCCCTCATCAGCGCAGAGAAGCGGCACCTCGTCTACTTCCCG
GGCGGCAACGGCAGCAATCATGTCCAGCGCCTCAACACACTGTCGCACGAATGCGAGACCATCAAGCTTCTGACC
TTTGCGCCCCGCTGCCTCGTTGCCGAGAACGGCTGGCTCTGCTGCGGCAGCGAGACGGGCGAGTTTGTGGCCATG
AACCTCGACGATGGCGGCGAAGATACCCATGCCTTCATGTCGACGCTCGACCTGGAAACGTCCCGACGCCACGCC
GGCGCCGACAGCCGGCGCGAAGACCCCCTCCTCTCCCTCCTGGCCCAGGCCCGCCGATCGAACAAGAGCTTGATA
GCCAAGAGCGTGAAGCTGGCCAAGGACCGCGTCAACTGCGTCACCCTCTGGTTCCCTCCACGACTCCTCTCCGCC
GTCCCGGAAGCCTACGCCGAGGCCGTCGCCGTGCTGGCCAACAACGACCGCACCGTCGTCCTCGTCAGCCTGCGC
GACTTCGAGCAGAGCGACAAGACGGAGCCCCTGGATGTCGTCACCTATCCTGACTTCGTCAACCGCGCCATCATC
TCGCCCGACGGCCAGTTTCTCATTGCCATCCTCGACGATCCATACCTCTACGTCCACCAGCGCTGCGAGCGGCCG
GCCGACGCGCCGCCTCCGGCCTCGGGCGCCAACAGCGGGTGGCAATGGGAGCTGAAGCAGAGGTACATGCTCAAG
AGCCAACGGAGGGACGACCGGACCGACAGCCGCGGCAGCTTCGCCGCCTGCTTCTCCCCCTCTGGCGCCTACCTG
GCCGTCGGAACCCAGCACGGCACCATCTCGATATTCGATGCGGCGCTGCTGGCCAAGCCGGCCGCCGAGCCCCTC
ATCACCACCTTCAAGTCGTCGCGCCCGGAAAGTGGCCAGGGAGCCGTCCGAGACATGGCCTTCTGCCCCGGTCCT
TTCGACATCCTGGCGTGGACGGAGGACCGCGGACACATTGGCTTTGCCGACATGCGGAGTAACTTCGTCATCCGC
CAGATCGTCAACATCAACGCCGACGTCGACTTCGAGCACATCGACATCCTGGACCGAAACACCATCGACCCTCGG
CTGTTGAACAGCCACGGCGAACGGCGAAGCAACCGGTCACCCTCGTCGGCGGTGACTCGCAGGCGGCACGGGGAG
GGACTCGAAACGCTGAACCAGCCCCTGACGGCCGACGAGACGGTCGTTCTCGAGGCCATTCAAGGAGACAGGAGG
CGGCGCGACCGTCAGAGGGCGGCAGGCAACGAGGACGCGTCCAGGAACGCGGATTTCTCGTGGACCTACCTGGCC
AACCTTCGAGCGTCTGCCGGCAATGACGGGGACTCTCAGCGGCCGCGAGAGCGAAGCAGCAGCGTCGGCCGGGCC
ATGGGAGACGGGCTGGGGTCGCATCGTGACCAGCGCGAGCGCGCATCGGAGCGCATCCGCACCGCGCGCCAGCTG
GTGCGCGAGGCTGGCGAGCAGCGGCAGCTGTTCCGCCGGCCGGACCAGCGGCTGATGGACCGGATCGGCGAGACG
GTCGCGGCCATGAGGGATCAAACGATCGCGGCCATAAACCCGCGCGAGAGGCCCGACTCGTCGTACCTCAACGTG
CTCGAAATGCTGCAGGCCAGGGAGCGCACGCCGGGCGAGACGGAGCACGACGACCCGTCGTTGCTTGTGCCGCTG
GTCAACCAGGCCATGAACCGGTGGGAGGAGAGCGCGATCCGCGGCACGCTGCCGGCCGACCACGGCGTCTTTGAG
GTGCCACCCTCGCCCGATAACACCGCCGGGTTGGCGTGGACTGCCGACGGTCGCACCCTGTTTGTCGGGGCCCAA
AACGGCATATACGAGCTACACATCAACGTCCACGGCAGGAAGCTTTGCCCCAGTATCACGATGCGCTGA
Gene >Hirsu2|10449
ATGGCCGTCAACGATGACGATCTGTTCGTCTCTCTCTCTCTGTCCCTGTCTCTCCTCCTCTCTTCCTCTCCCTCG
AGCCCTACGCTGCCTCTGTCTCTCTTCATCTCCGCCTGTCTCTCTCCCCCTCTTCCCCCTCCCCCTCCCTCCACC
CCTTGCCTCCTCATGCCCGTCCTTGCGCTGCCTTCCGTCTCACTCCGCCGCCGTGCGCCGAACCCGTTACTAATG
CCATCATGACCATCGACAGGTCCTTCCCGACCAACAGCATCGTTTCCAAGACGGCGCGCAGACACTACCGCGTCC
CCGTTCGATCGCAGTATTGCCTCCCTCCCCGCCCGTCCCCGCCGGGCCCCGGGGCTGGCTGACACGCAACCAGGC
ACTGGCAGCTGCGCTCCCTCATCAGCGCAGAGAAGCGGCACCTCGTCTACTTCCCGGGCGGCAACGGCAGCAATC
ATGTCCAGCGCCTCAACACACTGTCGCACGAATGCGAGACCATCAAGCTTCTGACCTTTGCGCCCCGCTGCCTCG
TTGCCGAGAACGGCTGGCTCTGCTGCGGCAGCGAGACGGGCGAGTTTGTGGCCATGAACCTCGACGATGGCGGCG
AAGATACCCATGCCTTCATGTCGACGCTCGACCTGGAAACGTCCCGACGCCACGCCGGCGCCGACAGCCGGCGCG
AAGACCCCCTCCTCTCCCTCCTGGCCCAGGCCCGCCGATCGAACAAGAGCTTGATAGCCAAGAGCGTGAAGCTGG
CCAAGGACCGCGTCAACTGCGTCACCCTCTGGTTCCCTCCACGACTCCTCTCCGCCGTCCCGGAAGCCTACGCCG
AGGCCGTCGCCGTGCTGGCCAACAACGACCGCACCGTCGTCCTCGTCAGCCTGCGCGACTTCGAGCAGAGCGACA
AGACGGAGCCCCTGGATGTCGTCACCTATCCTGACTTCGTCAACCGCGCCATCATCTCGCCCGACGGCCAGTTTC
TCATTGCCATCCTCGACGATCCATACCTCTACGTCCACCAGCGCTGCGAGCGGCCGGCCGACGCGCCGCCTCCGG
CCTCGGGCGCCAACAGCGGGTGGCAATGGGAGCTGAAGCAGAGGTACATGCTCAAGAGCCAACGGAGGGACGACC
GGACCGACAGCCGCGGCAGCTTCGCCGCCTGCTTCTCCCCCTCTGGCGCCTACCTGGCCGTCGGAACCCAGCACG
GCACCATCTCGATATTCGATGCGGCGCTGCTGGCCAAGCCGGCCGCCGAGCCCCTCATCACCACCTTCAAGTCGT
CGCGCCCGGAAAGTGGCCAGGGAGCCGTCCGAGACATGGCCTTCTGCCCCGGTCCTTTCGACATCCTGGCGTGGA
CGGAGGACCGCGGACACATTGGCTTTGCCGACATGCGGAGTAACTTCGTCATCCGCCAGATCGTCAACATCAACG
CCGACGTCGACTTCGAGCACATCGACATCCTGGACCGAAACACCATCGACCCTCGGCTGTTGAACAGCCACGGCG
AACGGCGAAGCAACCGGTCACCCTCGTCGGCGGTGACTCGCAGGCGGCACGGGGAGGGACTCGAAACGCTGAACC
AGCCCCTGACGGCCGACGAGACGGTCGTTCTCGAGGCCATTCAAGGAGACAGGAGGCGGCGCGACCGTCAGAGGG
CGGCAGGCAACGAGGACGCGTCCAGGAACGCGGATTTCTCGTGGACCTACCTGGCCAACCTTCGAGCGTCTGCCG
GCAATGACGGGGACTCTCAGCGGCCGCGAGAGCGAAGCAGCAGCGTCGGCCGGGCCATGGGAGACGGGCTGGGGT
CGCATCGTGACCAGCGCGAGCGCGCATCGGAGCGCATCCGCACCGCGCGCCAGCTGGTGCGCGAGGCTGGCGAGC
AGCGGCAGCTGTTCCGCCGGCCGGACCAGCGGCTGATGGACCGGATCGGCGAGACGGTCGCGGCCATGAGGGATC
AAACGATCGCGGCCATAAACCCGCGCGAGAGGCCCGACTCGTCGTACCTCAACGTGCTCGAAATGCTGCAGGCCA
GGGAGCGCACGCCGGGCGAGACGGAGCACGACGACCCGTCGTTGCTTGTGCCGCTGGTCAACCAGGCCATGAACC
GGTGGGAGGAGAGCGCGATCCGCGGCACGCTGCCGGCCGACCACGGCGTCTTTGAGGTGCCACCCTCGCCCGATA
ACACCGCCGGGTTGGCGTGGACTGCCGACGGTCGCACCCTGTACGTTGCCCCGAATCCCGCGGTGCCACAGTGGC
TTGCATGCTAACGGCTGGTTGCAGGTTTGTCGGGGCCCAAAACGGCATATACGAGCTACACATCAACGTCCACGG
CAGGAAGCTTTGCCCCAGTATCACGATGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail