Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10438
Gene name
LocationContig_843:5792..7547
Strand+
Gene length (bp)1755
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 6.4E-157 37 532

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTM4|TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct5 PE=3 SV=1 1 539 0.0E+00
sp|Q4R6V2|TCPE_MACFA T-complex protein 1 subunit epsilon OS=Macaca fascicularis GN=CCT5 PE=2 SV=1 3 536 0.0E+00
sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens GN=CCT5 PE=1 SV=1 3 536 0.0E+00
sp|Q5RF02|TCPE_PONAB T-complex protein 1 subunit epsilon OS=Pongo abelii GN=CCT5 PE=2 SV=1 3 536 0.0E+00
sp|Q68FQ0|TCPE_RAT T-complex protein 1 subunit epsilon OS=Rattus norvegicus GN=Cct5 PE=1 SV=1 3 536 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTM4|TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct5 PE=3 SV=1 1 539 0.0E+00
sp|Q4R6V2|TCPE_MACFA T-complex protein 1 subunit epsilon OS=Macaca fascicularis GN=CCT5 PE=2 SV=1 3 536 0.0E+00
sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens GN=CCT5 PE=1 SV=1 3 536 0.0E+00
sp|Q5RF02|TCPE_PONAB T-complex protein 1 subunit epsilon OS=Pongo abelii GN=CCT5 PE=2 SV=1 3 536 0.0E+00
sp|Q68FQ0|TCPE_RAT T-complex protein 1 subunit epsilon OS=Rattus norvegicus GN=Cct5 PE=1 SV=1 3 536 0.0E+00
sp|P80316|TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus GN=Cct5 PE=1 SV=1 3 536 0.0E+00
sp|P47209|TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans GN=cct-5 PE=2 SV=1 3 531 0.0E+00
sp|P40413|TCPE_YEAST T-complex protein 1 subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT5 PE=1 SV=3 2 536 0.0E+00
sp|O04450|TCPE_ARATH T-complex protein 1 subunit epsilon OS=Arabidopsis thaliana GN=CCT5 PE=1 SV=1 3 530 0.0E+00
sp|P54411|TCPE2_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 3 530 0.0E+00
sp|P40412|TCPE1_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 3 530 0.0E+00
sp|Q54TD3|TCPE_DICDI T-complex protein 1 subunit epsilon OS=Dictyostelium discoideum GN=cct5 PE=3 SV=1 3 533 0.0E+00
sp|Q8SRP9|TCPE_ENCCU T-complex protein 1 subunit epsilon OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT5 PE=1 SV=1 1 530 8.0E-178
sp|Q9YA66|THSB_AERPE Thermosome subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsB PE=3 SV=2 1 532 3.0E-123
sp|Q9YDK6|THSA_AERPE Thermosome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsA PE=3 SV=2 6 533 2.0E-122
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsA PE=3 SV=1 5 532 2.0E-122
sp|Q9V2S9|THSA_SULSO Thermosome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsA PE=3 SV=2 20 532 6.0E-120
sp|O24730|THSB_THEK1 Thermosome subunit beta OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsB PE=3 SV=2 6 538 4.0E-119
sp|Q52500|THSB_THEKO Thermosome subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsB PE=3 SV=1 6 538 1.0E-118
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ths PE=3 SV=1 19 532 2.0E-118
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ths PE=3 SV=1 6 532 2.0E-118
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ths PE=3 SV=1 19 532 2.0E-118
sp|Q9V2T5|THSA_SULAC Thermosome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsA PE=3 SV=2 20 532 4.0E-118
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ths PE=3 SV=1 6 532 7.0E-118
sp|P46219|THSA_SULSH Thermosome subunit alpha OS=Sulfolobus shibatae GN=thsA PE=1 SV=1 20 533 1.0E-117
sp|O26885|THSB_METTH Thermosome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsB PE=3 SV=1 5 532 3.0E-117
sp|Q9V2T3|THSB_DESMO Thermosome subunit beta (Fragment) OS=Desulfurococcus mobilis GN=thsB PE=3 SV=1 19 525 3.0E-117
sp|Q53546|THS_DESSY Thermosome subunit OS=Desulfurococcus sp. (strain SY) GN=ths PE=3 SV=1 6 538 4.0E-115
sp|O24734|THSA_SULTO Thermosome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsA PE=1 SV=1 19 533 6.0E-115
sp|O24732|THSB_THEK8 Thermosome subunit beta OS=Thermococcus sp. (strain KS-8) GN=thsB PE=3 SV=1 6 538 1.0E-114
sp|O93624|THS_METTL Thermosome subunit OS=Methanothermococcus thermolithotrophicus GN=ths PE=1 SV=1 19 532 2.0E-114
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsB PE=3 SV=1 5 532 2.0E-113
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsA PE=1 SV=1 6 532 7.0E-112
sp|P61111|THSA_THEKO Thermosome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsA PE=1 SV=1 6 532 5.0E-111
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsA PE=1 SV=1 6 532 5.0E-111
sp|Q9V2T8|THSB_SULSO Thermosome subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsB PE=3 SV=2 5 533 3.0E-110
sp|P28488|THSB_SULSH Thermosome subunit beta OS=Sulfolobus shibatae GN=thsB PE=1 SV=1 5 533 3.0E-110
sp|Q9V2T4|THSB_SULAC Thermosome subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsB PE=3 SV=2 5 533 2.0E-108
sp|O30561|THS1_HALVD Thermosome subunit 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct1 PE=1 SV=1 4 533 1.0E-107
sp|Q9LV21|TCPD_ARATH T-complex protein 1 subunit delta OS=Arabidopsis thaliana GN=CCT4 PE=1 SV=1 29 530 2.0E-107
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsB PE=1 SV=1 6 532 2.0E-107
sp|O24731|THSA_THEK8 Thermosome subunit alpha OS=Thermococcus sp. (strain KS-8) GN=thsA PE=3 SV=1 6 534 6.0E-107
sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens GN=CCT4 PE=1 SV=4 29 530 1.0E-103
sp|P53451|TCPD_TAKRU T-complex protein 1 subunit delta OS=Takifugu rubripes GN=cct4 PE=2 SV=1 29 530 1.0E-103
sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo abelii GN=CCT4 PE=2 SV=3 29 530 7.0E-103
sp|O24735|THSB_SULTO Thermosome subunit beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsB PE=1 SV=1 5 532 8.0E-103
sp|O26320|THSA_METTH Thermosome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsA PE=3 SV=2 9 532 4.0E-102
sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus musculus GN=Cct4 PE=1 SV=3 29 530 1.0E-101
sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos taurus GN=CCT4 PE=1 SV=3 29 530 1.0E-101
sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus norvegicus GN=Cct4 PE=1 SV=3 29 530 1.0E-100
sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyostelium discoideum GN=cct4 PE=3 SV=1 29 529 1.0E-100
sp|Q9NB32|TCPD_OCHTR T-complex protein 1 subunit delta OS=Ochlerotatus triseriatus PE=2 SV=1 28 530 3.0E-98
sp|Q9HN70|THSA_HALSA Thermosome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsA PE=3 SV=2 7 533 5.0E-95
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCT4 PE=3 SV=1 18 532 1.0E-94
sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta OS=Caenorhabditis elegans GN=cct-4 PE=2 SV=1 18 532 4.0E-94
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct4 PE=2 SV=2 20 532 6.0E-94
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCT4 PE=3 SV=1 18 532 9.0E-92
sp|Q9V2T7|THSG_SULSO Thermosome subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsC PE=3 SV=1 19 530 1.0E-91
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCT4 PE=3 SV=1 18 532 4.0E-91
sp|P39078|TCPD_YEAST T-complex protein 1 subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT4 PE=1 SV=2 18 532 5.0E-91
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCT4 PE=3 SV=1 25 532 1.0E-89
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 7 533 2.0E-89
sp|Q9HH21|THSG_SULSH Thermosome subunit gamma OS=Sulfolobus shibatae GN=thsC PE=3 SV=1 19 530 3.0E-88
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 8 537 5.0E-88
sp|P50143|TCPG_XENLA T-complex protein 1 subunit gamma OS=Xenopus laevis GN=cct3 PE=2 SV=2 6 533 1.0E-87
sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus GN=Cct3 PE=1 SV=1 7 533 1.0E-87
sp|Q9HNI0|THSB_HALSA Thermosome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsB PE=3 SV=2 5 533 2.0E-87
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 7 533 4.0E-87
sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens GN=CCT3 PE=1 SV=4 7 533 3.0E-86
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 7 533 4.0E-86
sp|Q4R963|TCPG_MACFA T-complex protein 1 subunit gamma OS=Macaca fascicularis GN=CCT3 PE=2 SV=1 7 533 2.0E-85
sp|O30560|THS2_HALVD Thermosome subunit 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct2 PE=1 SV=1 4 533 4.0E-85
sp|Q6C100|TCPD_YARLI T-complex protein 1 subunit delta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCT4 PE=3 SV=1 16 532 2.0E-84
sp|Q940P8|TCPB_ARATH T-complex protein 1 subunit beta OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 11 530 1.0E-81
sp|Q54TH8|TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum GN=cct3 PE=1 SV=1 7 529 2.0E-81
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 18 538 8.0E-80
sp|P28769|TCPA_ARATH T-complex protein 1 subunit alpha OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 20 530 1.0E-79
sp|O00782|TCPG_OXYGR T-complex protein 1 subunit gamma OS=Oxytricha granulifera PE=3 SV=1 7 537 3.0E-78
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 8 532 6.0E-78
sp|Q9LKI7|TCPG_THAWE T-complex protein 1 subunit gamma OS=Thalassiosira weissflogii PE=2 SV=1 5 539 7.0E-78
sp|P54409|TCPH_TETPY T-complex protein 1 subunit eta OS=Tetrahymena pyriformis PE=3 SV=1 7 530 5.0E-77
sp|Q9HHA2|THS3_HALVD Thermosome subunit 3 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct3 PE=1 SV=2 20 532 1.0E-76
sp|Q94757|TCPA_SCHMA T-complex protein 1 subunit alpha OS=Schistosoma mansoni GN=TCP-1A PE=2 SV=1 19 530 1.0E-76
sp|P18279|TCPA_CRIGR T-complex protein 1 subunit alpha OS=Cricetulus griseus GN=TCP1 PE=2 SV=1 25 530 4.0E-76
sp|Q32L40|TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus GN=TCP1 PE=1 SV=1 25 530 5.0E-76
sp|P48605|TCPG_DROME T-complex protein 1 subunit gamma OS=Drosophila melanogaster GN=Cctgamma PE=2 SV=2 6 533 6.0E-76
sp|Q10147|TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct2 PE=3 SV=1 8 530 7.0E-76
sp|Q3ZBH0|TCPB_BOVIN T-complex protein 1 subunit beta OS=Bos taurus GN=CCT2 PE=1 SV=3 29 530 1.0E-75
sp|Q54ES9|TCPB_DICDI T-complex protein 1 subunit beta OS=Dictyostelium discoideum GN=cct2 PE=1 SV=1 5 530 2.0E-75
sp|Q9XT06|TCPA_MONDO T-complex protein 1 subunit alpha OS=Monodelphis domestica GN=TCP1 PE=2 SV=1 19 530 2.0E-75
sp|O15891|TCPA_TETPY T-complex protein 1 subunit alpha OS=Tetrahymena pyriformis PE=3 SV=1 13 530 2.0E-75
sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens GN=TCP1 PE=1 SV=1 20 530 3.0E-75
sp|O77323|TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P3.6 PE=3 SV=1 10 530 3.0E-75
sp|Q55BM4|TCPA_DICDI T-complex protein 1 subunit alpha OS=Dictyostelium discoideum GN=tcp1 PE=2 SV=1 20 530 4.0E-75
sp|Q5XIM9|TCPB_RAT T-complex protein 1 subunit beta OS=Rattus norvegicus GN=Cct2 PE=1 SV=3 29 530 5.0E-75
sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus GN=Tcp1 PE=1 SV=3 25 530 6.0E-75
sp|Q84WV1|TCPG_ARATH T-complex protein 1 subunit gamma OS=Arabidopsis thaliana GN=CCT3 PE=1 SV=1 8 534 1.0E-74
sp|Q4R6F8|TCPB_MACFA T-complex protein 1 subunit beta OS=Macaca fascicularis GN=CCT2 PE=2 SV=3 29 530 2.0E-74
sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens GN=CCT2 PE=1 SV=4 29 530 2.0E-74
sp|P28480|TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus GN=Tcp1 PE=1 SV=1 25 530 3.0E-74
sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus GN=Cct2 PE=1 SV=4 29 530 3.0E-74
sp|P12613|TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster GN=T-cp1 PE=2 SV=2 20 530 3.0E-74
sp|P54408|TCPG_TETPY T-complex protein 1 subunit gamma OS=Tetrahymena pyriformis PE=3 SV=1 6 534 8.0E-74
sp|Q4R5G2|TCPA_MACFA T-complex protein 1 subunit alpha OS=Macaca fascicularis GN=TCP1 PE=2 SV=1 25 530 9.0E-74
sp|P41988|TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans GN=cct-1 PE=3 SV=2 19 530 2.0E-73
sp|P47207|TCPB_CAEEL T-complex protein 1 subunit beta OS=Caenorhabditis elegans GN=cct-2 PE=1 SV=2 8 530 4.0E-73
sp|P39076|TCPB_YEAST T-complex protein 1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT2 PE=1 SV=1 29 530 7.0E-73
sp|O94501|TCPA_SCHPO T-complex protein 1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct1 PE=3 SV=1 23 530 2.0E-72
sp|Q9W790|TCPA_PALPA T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus GN=TCP1 PE=2 SV=1 19 530 4.0E-72
sp|Q54ER7|TCPH_DICDI T-complex protein 1 subunit eta OS=Dictyostelium discoideum GN=cct7 PE=3 SV=1 7 530 3.0E-71
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 10 530 6.0E-71
sp|Q8SSC9|TCPA_ENCCU T-complex protein 1 subunit alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TCP1 PE=1 SV=1 23 531 3.0E-70
sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 10 530 5.0E-70
sp|Q5R5C8|TCPH_PONAB T-complex protein 1 subunit eta OS=Pongo abelii GN=CCT7 PE=2 SV=1 10 530 7.0E-70
sp|Q92526|TCPW_HUMAN T-complex protein 1 subunit zeta-2 OS=Homo sapiens GN=CCT6B PE=1 SV=5 30 534 6.0E-69
sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 10 530 5.0E-68
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 8 530 5.0E-68
sp|Q2NKZ1|TCPH_BOVIN T-complex protein 1 subunit eta OS=Bos taurus GN=CCT7 PE=1 SV=1 10 530 7.0E-68
sp|P12612|TCPA_YEAST T-complex protein 1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCP1 PE=1 SV=2 23 530 1.0E-67
sp|Q5ZJ54|TCPZ_CHICK T-complex protein 1 subunit zeta OS=Gallus gallus GN=CCT6 PE=1 SV=3 26 534 1.0E-67
sp|Q5RCD2|TCPZ_PONAB T-complex protein 1 subunit zeta OS=Pongo abelii GN=CCT6 PE=2 SV=3 26 534 1.0E-66
sp|Q9SF16|TCPH_ARATH T-complex protein 1 subunit eta OS=Arabidopsis thaliana GN=CCT7 PE=1 SV=1 7 530 2.0E-66
sp|Q8SR76|TCPG_ENCCU T-complex protein 1 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT3 PE=1 SV=1 9 532 2.0E-66
sp|Q61390|TCPW_MOUSE T-complex protein 1 subunit zeta-2 OS=Mus musculus GN=Cct6b PE=1 SV=4 26 534 3.0E-66
sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens GN=CCT6A PE=1 SV=3 26 534 1.0E-65
sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus GN=Cct6a PE=1 SV=3 26 534 1.0E-65
sp|Q3MHL7|TCPZ_BOVIN T-complex protein 1 subunit zeta OS=Bos taurus GN=CCT6A PE=1 SV=3 26 534 2.0E-65
sp|O77622|TCPZ_RABIT T-complex protein 1 subunit zeta OS=Oryctolagus cuniculus GN=CCT6 PE=1 SV=3 26 534 7.0E-65
sp|Q3T084|TCPW_BOVIN T-complex protein 1 subunit zeta-2 OS=Bos taurus GN=CCT6B PE=2 SV=3 26 534 7.0E-64
sp|P46550|TCPZ_CAEEL T-complex protein 1 subunit zeta OS=Caenorhabditis elegans GN=cct-6 PE=1 SV=1 26 534 6.0E-63
sp|P78921|TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct8 PE=2 SV=3 15 532 9.0E-63
sp|A8X6I9|TCPQ_CAEBR T-complex protein 1 subunit theta OS=Caenorhabditis briggsae GN=cct-8 PE=3 SV=1 15 532 5.0E-62
sp|O94515|TCPZ_SCHPO T-complex protein 1 subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct6 PE=3 SV=1 25 478 1.0E-61
sp|Q8SQP2|TCPB_ENCCU T-complex protein 1 subunit beta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT2 PE=1 SV=1 23 530 2.0E-58
sp|P39079|TCPZ_YEAST T-complex protein 1 subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT6 PE=1 SV=1 26 473 2.0E-57
sp|Q6EE31|TCPQ_CHICK T-complex protein 1 subunit theta OS=Gallus gallus GN=CCT8 PE=1 SV=3 9 532 9.0E-57
sp|Q8L7N0|TCPZB_ARATH T-complex protein 1 subunit zeta 2 OS=Arabidopsis thaliana GN=CCT6B PE=1 SV=1 26 533 1.0E-56
sp|Q9N358|TCPQ_CAEEL T-complex protein 1 subunit theta OS=Caenorhabditis elegans GN=cct-8 PE=1 SV=3 15 532 2.0E-55
sp|Q76NU3|TCPZ_DICDI T-complex protein 1 subunit zeta OS=Dictyostelium discoideum GN=cct6 PE=1 SV=1 11 477 7.0E-55
sp|Q9M888|TCPZA_ARATH T-complex protein 1 subunit zeta 1 OS=Arabidopsis thaliana GN=CCT6A PE=1 SV=1 26 533 3.0E-54
sp|Q552J0|TCPQ_DICDI T-complex protein 1 subunit theta OS=Dictyostelium discoideum GN=cct8 PE=3 SV=1 16 532 1.0E-53
sp|Q8SR53|TCPH_ENCCU T-complex protein 1 subunit eta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT7 PE=1 SV=1 23 532 1.0E-52
sp|Q8SSH3|TCPD_ENCCU T-complex protein 1 subunit delta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT4 PE=1 SV=1 24 530 4.0E-52
sp|P54410|TCPH_TETTH T-complex protein 1 subunit eta (Fragment) OS=Tetrahymena thermophila PE=3 SV=1 65 417 2.0E-51
sp|Q94K05|TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana GN=CCT8 PE=1 SV=1 24 532 2.0E-51
sp|P47079|TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT8 PE=1 SV=1 15 532 8.0E-48
sp|Q3ZCI9|TCPQ_BOVIN T-complex protein 1 subunit theta OS=Bos taurus GN=CCT8 PE=1 SV=3 9 532 1.0E-47
sp|Q5RAP1|TCPQ_PONAB T-complex protein 1 subunit theta OS=Pongo abelii GN=CCT8 PE=2 SV=3 9 532 8.0E-47
sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens GN=CCT8 PE=1 SV=4 9 532 8.0E-47
sp|Q4R5J0|TCPQ_MACFA T-complex protein 1 subunit theta OS=Macaca fascicularis GN=CCT8 PE=2 SV=1 9 532 1.0E-46
sp|P42932|TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus GN=Cct8 PE=1 SV=3 25 532 2.0E-46
sp|P47828|TCPQ_CANAX T-complex protein 1 subunit theta OS=Candida albicans GN=CCT8 PE=3 SV=2 15 532 2.0E-38
sp|Q96SF2|TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens GN=CCT8L2 PE=2 SV=2 29 532 7.0E-34
sp|A6NM43|TCPQL_HUMAN Putative T-complex protein 1 subunit theta-like 1 OS=Homo sapiens GN=CCT8L1P PE=5 SV=1 29 532 2.0E-32
sp|P48212|CH60_CLOTH 60 kDa chaperonin OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=groL PE=1 SV=3 18 530 2.0E-22
sp|B9E899|CH60_MACCJ 60 kDa chaperonin OS=Macrococcus caseolyticus (strain JCSC5402) GN=groL PE=3 SV=1 18 537 3.0E-21
sp|C4Z3R4|CH60_EUBE2 60 kDa chaperonin OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=groL PE=3 SV=1 18 532 3.0E-21
sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=groL PE=3 SV=1 21 537 3.0E-21
sp|Q71XU6|CH60_LISMF 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain F2365) GN=groL PE=3 SV=1 21 537 3.0E-21
sp|C1KX21|CH60_LISMC 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=groL PE=3 SV=1 21 537 3.0E-21
sp|A0AKH5|CH60_LISW6 60 kDa chaperonin OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=groL PE=3 SV=1 21 537 4.0E-21
sp|Q929V0|CH60_LISIN 60 kDa chaperonin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=groL PE=3 SV=1 21 537 5.0E-21
sp|B8DH59|CH60_LISMH 60 kDa chaperonin OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=groL PE=3 SV=1 21 537 5.0E-21
sp|O32847|CH60_LACZE 60 kDa chaperonin OS=Lactobacillus zeae GN=groL PE=3 SV=1 18 530 1.0E-20
sp|B3W9W7|CH60_LACCB 60 kDa chaperonin OS=Lactobacillus casei (strain BL23) GN=groL PE=3 SV=1 18 530 1.0E-20
sp|Q035Y9|CH60_LACC3 60 kDa chaperonin OS=Lactobacillus casei (strain ATCC 334) GN=groL PE=3 SV=1 18 530 1.0E-20
sp|Q8VV84|CH60_GEOTM 60 kDa chaperonin OS=Geobacillus thermoglucosidasius GN=groL PE=3 SV=1 18 537 2.0E-20
sp|Q9KJ23|CH60_LACJO 60 kDa chaperonin OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=groL PE=3 SV=2 18 530 3.0E-20
sp|Q4MPR6|CH60_BACCE 60 kDa chaperonin OS=Bacillus cereus GN=groL PE=1 SV=3 21 530 4.0E-20
sp|A7GKG0|CH60_BACCN 60 kDa chaperonin OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=groL PE=3 SV=1 21 537 4.0E-20
sp|B7IUT0|CH60_BACC2 60 kDa chaperonin OS=Bacillus cereus (strain G9842) GN=groL PE=3 SV=1 21 530 4.0E-20
sp|Q93G07|CH60_LACAC 60 kDa chaperonin OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=groL PE=3 SV=2 21 530 4.0E-20
sp|Q38YR7|CH60_LACSS 60 kDa chaperonin OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=groL PE=3 SV=1 18 537 6.0E-20
sp|C4ZD46|CH60_EUBR3 60 kDa chaperonin OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=groL PE=3 SV=1 18 532 1.0E-19
sp|Q5WJN4|CH60_BACSK 60 kDa chaperonin OS=Bacillus clausii (strain KSM-K16) GN=groL PE=3 SV=1 21 537 1.0E-19
sp|Q814B0|CH60_BACCR 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=groL PE=3 SV=1 21 530 1.0E-19
sp|B7H4Q7|CH60_BACC4 60 kDa chaperonin OS=Bacillus cereus (strain B4264) GN=groL PE=3 SV=1 21 530 2.0E-19
sp|A6TLJ1|CH60_ALKMQ 60 kDa chaperonin OS=Alkaliphilus metalliredigens (strain QYMF) GN=groL PE=3 SV=1 18 531 2.0E-19
sp|A7Z207|CH60_BACMF 60 kDa chaperonin OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=groL PE=3 SV=1 21 537 2.0E-19
sp|A9BHK4|CH60_PETMO 60 kDa chaperonin OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=groL PE=3 SV=1 18 524 3.0E-19
sp|A9VQG8|CH60_BACWK 60 kDa chaperonin OS=Bacillus weihenstephanensis (strain KBAB4) GN=groL PE=3 SV=1 21 530 3.0E-19
sp|C5D4F4|CH60_GEOSW 60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1 18 537 4.0E-19
sp|Q9EZV1|CH60_THENE 60 kDa chaperonin OS=Thermotoga neapolitana GN=groL PE=3 SV=1 21 537 5.0E-19
sp|Q9WYX6|CH60_THEMA 60 kDa chaperonin OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=groL PE=3 SV=1 21 537 5.0E-19
sp|Q045Q8|CH60_LACGA 60 kDa chaperonin OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=groL PE=3 SV=1 21 530 5.0E-19
sp|A7HNA3|CH60_FERNB 60 kDa chaperonin OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=groL PE=3 SV=1 21 536 6.0E-19
sp|Q81VE1|CH60_BACAN 60 kDa chaperonin OS=Bacillus anthracis GN=groL PE=3 SV=1 21 530 8.0E-19
sp|C3L507|CH60_BACAC 60 kDa chaperonin OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=groL PE=3 SV=1 21 530 8.0E-19
sp|C3PAV1|CH60_BACAA 60 kDa chaperonin OS=Bacillus anthracis (strain A0248) GN=groL PE=3 SV=1 21 530 8.0E-19
sp|B8D0Z4|CH60_HALOH 60 kDa chaperonin OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=groL PE=3 SV=1 18 538 8.0E-19
sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin OS=Geobacillus kaustophilus (strain HTA426) GN=groL PE=3 SV=1 18 537 9.0E-19
sp|P28598|CH60_BACSU 60 kDa chaperonin OS=Bacillus subtilis (strain 168) GN=groL PE=1 SV=3 18 537 9.0E-19
sp|Q6HPC7|CH60_BACHK 60 kDa chaperonin OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=groL PE=3 SV=1 21 530 9.0E-19
sp|Q63GV7|CH60_BACCZ 60 kDa chaperonin OS=Bacillus cereus (strain ZK / E33L) GN=groL PE=3 SV=1 21 530 9.0E-19
sp|B9J1H2|CH60_BACCQ 60 kDa chaperonin OS=Bacillus cereus (strain Q1) GN=groL PE=3 SV=1 21 530 9.0E-19
sp|B7HS05|CH60_BACC7 60 kDa chaperonin OS=Bacillus cereus (strain AH187) GN=groL PE=3 SV=1 21 530 9.0E-19
sp|C1EUB1|CH60_BACC3 60 kDa chaperonin OS=Bacillus cereus (strain 03BB102) GN=groL PE=3 SV=1 21 530 9.0E-19
sp|Q73ER9|CH60_BACC1 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=groL PE=3 SV=2 21 530 9.0E-19
sp|B7JM60|CH60_BACC0 60 kDa chaperonin OS=Bacillus cereus (strain AH820) GN=groL PE=3 SV=1 21 530 9.0E-19
sp|A0R8W4|CH60_BACAH 60 kDa chaperonin OS=Bacillus thuringiensis (strain Al Hakam) GN=groL PE=3 SV=1 21 530 9.0E-19
sp|B1L8Y8|CH60_THESQ 60 kDa chaperonin OS=Thermotoga sp. (strain RQ2) GN=groL PE=3 SV=1 21 537 1.0E-18
sp|A5IJR6|CH60_THEP1 60 kDa chaperonin OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=groL PE=3 SV=1 21 537 1.0E-18
sp|Q2RL13|CH601_MOOTA 60 kDa chaperonin 1 OS=Moorella thermoacetica (strain ATCC 39073) GN=groL1 PE=3 SV=1 18 530 1.0E-18
sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1 18 537 1.0E-18
sp|B2GAI0|CH60_LACF3 60 kDa chaperonin OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=groL PE=3 SV=1 18 530 2.0E-18
sp|Q29068|TCPG_PIG T-complex protein 1 subunit gamma (Fragment) OS=Sus scrofa GN=CCT3 PE=2 SV=1 33 113 2.0E-18
sp|A8YTH8|CH60_LACH4 60 kDa chaperonin OS=Lactobacillus helveticus (strain DPC 4571) GN=groL PE=3 SV=1 21 530 3.0E-18
sp|Q65MZ8|CH60_BACLD 60 kDa chaperonin OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=groL PE=3 SV=1 21 537 3.0E-18
sp|A8MJJ7|CH60_ALKOO 60 kDa chaperonin OS=Alkaliphilus oremlandii (strain OhILAs) GN=groL PE=3 SV=1 18 531 3.0E-18
sp|O50305|CH60_BACHD 60 kDa chaperonin OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=groL PE=2 SV=2 21 538 4.0E-18
sp|B7IFA6|CH60_THEAB 60 kDa chaperonin OS=Thermosipho africanus (strain TCF52B) GN=groL PE=3 SV=1 18 531 6.0E-18
sp|B7GFR6|CH60_ANOFW 60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1 18 537 8.0E-18
sp|O68324|CH60_LACHE 60 kDa chaperonin OS=Lactobacillus helveticus GN=groL PE=3 SV=1 21 530 9.0E-18
sp|A6LJ30|CH60_THEM4 60 kDa chaperonin OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=groL PE=3 SV=1 18 531 9.0E-18
sp|Q6A6W2|CH602_PROAC 60 kDa chaperonin 2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=groL2 PE=3 SV=1 18 538 1.0E-17
sp|Q07201|CH60_GEOSE 60 kDa chaperonin OS=Geobacillus stearothermophilus GN=groL PE=2 SV=1 18 537 1.0E-17
sp|Q8SS33|TCPQ_ENCCU T-complex protein 1 subunit theta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT8 PE=1 SV=1 24 448 1.0E-17
sp|Q60024|CH60_THEBR 60 kDa chaperonin OS=Thermoanaerobacter brockii GN=groL PE=1 SV=2 18 537 1.0E-17
sp|Q1WSW0|CH60_LACS1 60 kDa chaperonin OS=Lactobacillus salivarius (strain UCC118) GN=groL PE=3 SV=1 18 530 2.0E-17
sp|B3DZP5|CH60_METI4 60 kDa chaperonin OS=Methylacidiphilum infernorum (isolate V4) GN=groL PE=3 SV=1 22 530 2.0E-17
sp|Q3BY61|CH60_XANC5 60 kDa chaperonin OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=groL PE=3 SV=1 21 524 2.0E-17
sp|Q13NE4|CH604_BURXL 60 kDa chaperonin 4 OS=Burkholderia xenovorans (strain LB400) GN=groL4 PE=3 SV=1 37 530 3.0E-17
sp|P26209|CH60_BACP3 60 kDa chaperonin OS=Bacillus sp. (strain PS3) GN=groL PE=3 SV=1 18 537 3.0E-17
sp|A9KSJ1|CH60_CLOPH 60 kDa chaperonin OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=groL PE=3 SV=1 37 532 3.0E-17
sp|B0K3P6|CH60_THEPX 60 kDa chaperonin OS=Thermoanaerobacter sp. (strain X514) GN=groL PE=3 SV=1 18 537 3.0E-17
sp|B0KBR3|CH60_THEP3 60 kDa chaperonin OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=groL PE=3 SV=1 18 537 3.0E-17
sp|A5G9I2|CH60_GEOUR 60 kDa chaperonin OS=Geobacter uraniireducens (strain Rf4) GN=groL PE=3 SV=1 21 530 4.0E-17
sp|Q46CA1|CH60_METBF 60 kDa chaperonin OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=groL PE=3 SV=1 18 538 4.0E-17
sp|Q8RIT7|CH60_XANCH 60 kDa chaperonin OS=Xanthomonas campestris pv. phaseoli GN=groL PE=3 SV=1 21 524 5.0E-17
sp|B2T0I0|CH60_BURPP 60 kDa chaperonin OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=groL PE=3 SV=1 22 530 5.0E-17
sp|Q8PPZ1|CH60_XANAC 60 kDa chaperonin OS=Xanthomonas axonopodis pv. citri (strain 306) GN=groL PE=3 SV=1 21 524 5.0E-17
sp|B9LZ35|CH60_GEODF 60 kDa chaperonin OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=groL PE=3 SV=1 21 530 5.0E-17
sp|Q03VC3|CH60_LEUMM 60 kDa chaperonin OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=groL PE=3 SV=1 18 530 5.0E-17
sp|A5WD52|CH60_PSYWF 60 kDa chaperonin OS=Psychrobacter sp. (strain PRwf-1) GN=groL PE=3 SV=1 18 530 6.0E-17
sp|B8I5W0|CH60_CLOCE 60 kDa chaperonin OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=groL PE=3 SV=1 18 530 6.0E-17
sp|A7HGP8|CH602_ANADF 60 kDa chaperonin 2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=groL2 PE=3 SV=1 22 524 6.0E-17
sp|P47632|CH60_MYCGE 60 kDa chaperonin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=groL PE=3 SV=1 22 527 7.0E-17
sp|Q5GUT1|CH60_XANOR 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=groL PE=3 SV=1 21 524 7.0E-17
sp|B2SJG4|CH60_XANOP 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=groL PE=3 SV=1 21 524 7.0E-17
sp|Q2NY29|CH60_XANOM 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=groL PE=3 SV=1 21 524 7.0E-17
sp|Q88YM5|CH60_LACPL 60 kDa chaperonin OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=groL PE=3 SV=1 18 530 8.0E-17
sp|B2JFE0|CH60_BURP8 60 kDa chaperonin OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=groL PE=3 SV=1 22 530 8.0E-17
sp|Q8CXL3|CH60_OCEIH 60 kDa chaperonin OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=groL PE=3 SV=1 18 537 9.0E-17
sp|A1TKQ5|CH60_ACIAC 60 kDa chaperonin OS=Acidovorax citrulli (strain AAC00-1) GN=groL PE=3 SV=1 22 524 9.0E-17
sp|Q93EU6|CH60_ENTFA 60 kDa chaperonin OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=groL PE=3 SV=2 18 530 1.0E-16
sp|Q144Q6|CH601_BURXL 60 kDa chaperonin 1 OS=Burkholderia xenovorans (strain LB400) GN=groL1 PE=3 SV=1 22 530 1.0E-16
sp|Q93GT6|CH60_TETHA 60 kDa chaperonin OS=Tetragenococcus halophilus GN=groL PE=3 SV=2 18 203 1.0E-16
sp|B3E8G0|CH60_GEOLS 60 kDa chaperonin OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=groL PE=3 SV=1 18 530 1.0E-16
sp|B9MDC5|CH60_ACIET 60 kDa chaperonin OS=Acidovorax ebreus (strain TPSY) GN=groL PE=3 SV=1 22 524 1.0E-16
sp|Q39ZP5|CH60_GEOMG 60 kDa chaperonin OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=groL PE=3 SV=1 21 530 1.0E-16
sp|Q8R5T7|CH60_CALS4 60 kDa chaperonin OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=groL PE=3 SV=1 18 531 2.0E-16
sp|Q2LTG7|CH602_SYNAS 60 kDa chaperonin 2 OS=Syntrophus aciditrophicus (strain SB) GN=groL2 PE=3 SV=1 16 536 2.0E-16
sp|Q8TGX7|CH60_METAC 60 kDa chaperonin OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=groL PE=3 SV=1 18 538 2.0E-16
sp|A8FAG3|CH60_BACP2 60 kDa chaperonin OS=Bacillus pumilus (strain SAFR-032) GN=groL PE=3 SV=1 21 530 2.0E-16
sp|A6LQ87|CH60_CLOB8 60 kDa chaperonin OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=groL PE=3 SV=1 18 524 2.0E-16
sp|A8F401|CH60_PSELT 60 kDa chaperonin OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=groL PE=3 SV=1 21 537 3.0E-16
sp|B9KCR7|CH60_CAMLR 60 kDa chaperonin OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=groL PE=3 SV=1 22 530 3.0E-16
sp|Q5SLM2|CH60_THET8 60 kDa chaperonin OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=groL PE=1 SV=3 37 530 4.0E-16
sp|P61490|CH60_THET2 60 kDa chaperonin OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=groL PE=1 SV=2 37 530 4.0E-16
sp|Q4JTF2|CH602_CORJK 60 kDa chaperonin 2 OS=Corynebacterium jeikeium (strain K411) GN=groL2 PE=3 SV=1 37 531 4.0E-16
sp|A1W3W8|CH60_ACISJ 60 kDa chaperonin OS=Acidovorax sp. (strain JS42) GN=groL PE=3 SV=1 22 524 5.0E-16
sp|A0K536|CH601_BURCH 60 kDa chaperonin 1 OS=Burkholderia cenocepacia (strain HI2424) GN=groL1 PE=3 SV=1 22 530 6.0E-16
sp|Q1BYL5|CH601_BURCA 60 kDa chaperonin 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=groL1 PE=3 SV=1 22 530 6.0E-16
sp|Q1D3Y5|CH601_MYXXD 60 kDa chaperonin 1 OS=Myxococcus xanthus (strain DK 1622) GN=groL1 PE=3 SV=1 19 530 6.0E-16
sp|Q29236|TCPZ_PIG T-complex protein 1 subunit zeta (Fragment) OS=Sus scrofa GN=CCT6 PE=2 SV=1 26 123 7.0E-16
sp|P58723|CH60_BURTH 60 kDa chaperonin OS=Burkholderia thailandensis GN=groL PE=3 SV=1 22 530 7.0E-16
sp|Q2SYJ5|CH601_BURTA 60 kDa chaperonin 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL1 PE=3 SV=1 22 530 7.0E-16
sp|B1YEP6|CH60_EXIS2 60 kDa chaperonin OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=groL PE=3 SV=1 22 530 7.0E-16
sp|C6DY43|CH60_GEOSM 60 kDa chaperonin OS=Geobacter sp. (strain M21) GN=groL PE=3 SV=1 21 530 7.0E-16
sp|P50157|TCPA_AMBME T-complex protein 1 subunit alpha (Fragment) OS=Ambystoma mexicanum PE=2 SV=1 386 538 8.0E-16
sp|Q9ZFE0|CH60_BURCE 60 kDa chaperonin OS=Burkholderia cepacia GN=groL PE=3 SV=1 22 530 8.0E-16
sp|B2FIU9|CH60_STRMK 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain K279a) GN=groL PE=3 SV=1 21 145 9.0E-16
sp|B8E1A9|CH60_DICTD 60 kDa chaperonin OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=groL PE=3 SV=1 36 530 9.0E-16
sp|Q9RWQ9|CH60_DEIRA 60 kDa chaperonin OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=groL PE=1 SV=3 18 530 1.0E-15
sp|Q9ZFD8|CH60_BURVI 60 kDa chaperonin OS=Burkholderia vietnamiensis GN=groL PE=3 SV=1 22 530 1.0E-15
sp|A4JC03|CH601_BURVG 60 kDa chaperonin 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL1 PE=3 SV=1 22 530 1.0E-15
sp|B1HT15|CH60_LYSSC 60 kDa chaperonin OS=Lysinibacillus sphaericus (strain C3-41) GN=groL PE=3 SV=1 21 530 1.0E-15
sp|Q8R5X7|CH60_FUSNN 60 kDa chaperonin OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=groL PE=3 SV=1 22 536 1.0E-15
sp|Q39J12|CH602_BURL3 60 kDa chaperonin 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=groL2 PE=3 SV=1 22 530 1.0E-15
sp|A4XJ09|CH60_CALS8 60 kDa chaperonin OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|A1W0K4|CH60_CAMJJ 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|O69289|CH60_CAMJE 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=groL PE=3 SV=2 22 530 2.0E-15
sp|A7H2F8|CH60_CAMJD 60 kDa chaperonin OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|A8FMS6|CH60_CAMJ8 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|Q5HTP2|CH60_CAMJR 60 kDa chaperonin OS=Campylobacter jejuni (strain RM1221) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|Q0BHT1|CH601_BURCM 60 kDa chaperonin 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL1 PE=3 SV=1 22 530 2.0E-15
sp|A7HAD3|CH601_ANADF 60 kDa chaperonin 1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=groL1 PE=3 SV=1 18 530 2.0E-15
sp|B9MLY9|CH60_CALBD 60 kDa chaperonin OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|Q3JPF6|CH601_BURP1 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1710b) GN=groL1 PE=3 SV=1 22 530 2.0E-15
sp|A3NYH0|CH601_BURP0 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1106a) GN=groL1 PE=3 SV=1 22 530 2.0E-15
sp|B0TCA0|CH60_HELMI 60 kDa chaperonin OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=groL PE=3 SV=1 22 538 2.0E-15
sp|A1V1Z9|CH60_BURMS 60 kDa chaperonin OS=Burkholderia mallei (strain SAVP1) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|Q62I82|CH60_BURMA 60 kDa chaperonin OS=Burkholderia mallei (strain ATCC 23344) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|A2S9S5|CH60_BURM9 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10229) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|A3MMB4|CH60_BURM7 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10247) GN=groL PE=3 SV=1 22 530 2.0E-15
sp|Q048Y3|CH60_LACDB 60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=groL PE=3 SV=1 21 530 2.0E-15
sp|Q1G937|CH60_LACDA 60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=groL PE=3 SV=1 21 530 2.0E-15
sp|Q8PD23|CH60_XANCP 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=groL PE=3 SV=1 21 145 2.0E-15
sp|Q4UZA7|CH60_XANC8 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain 8004) GN=groL PE=3 SV=1 21 145 2.0E-15
sp|A7GZ43|CH60_CAMC5 60 kDa chaperonin OS=Campylobacter curvus (strain 525.92) GN=groL PE=3 SV=1 35 530 2.0E-15
sp|B5E9Y2|CH60_GEOBB 60 kDa chaperonin OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=groL PE=3 SV=1 21 530 2.0E-15
sp|Q67KB8|CH60_SYMTH 60 kDa chaperonin OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=groL PE=3 SV=1 10 524 2.0E-15
sp|B0RN52|CH60_XANCB 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain B100) GN=groL PE=3 SV=1 21 145 2.0E-15
sp|B9DMM2|CH60_STACT 60 kDa chaperonin OS=Staphylococcus carnosus (strain TM300) GN=groL PE=3 SV=1 18 538 2.0E-15
sp|Q8CX00|CH60_STRA5 60 kDa chaperonin OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=groL PE=3 SV=1 18 530 2.0E-15
sp|Q3JYQ0|CH60_STRA1 60 kDa chaperonin OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=groL PE=3 SV=1 18 530 2.0E-15
sp|Q04E64|CH60_OENOB 60 kDa chaperonin OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=groL PE=3 SV=1 37 530 3.0E-15
sp|C3KUC8|CH60_CLOB6 60 kDa chaperonin OS=Clostridium botulinum (strain 657 / Type Ba4) GN=groL PE=3 SV=1 22 524 3.0E-15
sp|Q9F712|CH601_BURPS 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain K96243) GN=groL1 PE=3 SV=2 22 530 3.0E-15
sp|A3NCQ8|CH601_BURP6 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 668) GN=groL1 PE=3 SV=1 22 530 3.0E-15
sp|C3K1A0|CH60_PSEFS 60 kDa chaperonin OS=Pseudomonas fluorescens (strain SBW25) GN=groL PE=3 SV=1 18 530 3.0E-15
sp|Q3K7L6|CH60_PSEPF 60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf0-1) GN=groL PE=3 SV=1 18 524 3.0E-15
sp|Q6ARV6|CH60_DESPS 60 kDa chaperonin OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=groL PE=3 SV=1 21 348 3.0E-15
sp|Q9KKF0|CH60_PEPDI 60 kDa chaperonin OS=Peptoclostridium difficile GN=groL PE=3 SV=1 18 524 3.0E-15
sp|A9I685|CH60_BORPD 60 kDa chaperonin OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=groL PE=3 SV=1 18 531 3.0E-15
sp|Q7NT31|CH601_CHRVO 60 kDa chaperonin 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL1 PE=3 SV=1 18 530 4.0E-15
sp|Q0KDR7|CH60_CUPNH 60 kDa chaperonin OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=groL PE=3 SV=1 22 524 4.0E-15
sp|Q18CT5|CH60_PEPD6 60 kDa chaperonin OS=Peptoclostridium difficile (strain 630) GN=groL PE=3 SV=1 18 524 4.0E-15
sp|Q2LU42|CH603_SYNAS 60 kDa chaperonin 3 OS=Syntrophus aciditrophicus (strain SB) GN=groL3 PE=3 SV=1 36 530 5.0E-15
sp|A7I0W5|CH60_CAMHC 60 kDa chaperonin OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=groL PE=3 SV=1 22 524 5.0E-15
sp|Q9AME7|CH60_STRAG 60 kDa chaperonin OS=Streptococcus agalactiae GN=groL PE=3 SV=1 18 530 5.0E-15
sp|Q03H05|CH60_PEDPA 60 kDa chaperonin OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=groL PE=3 SV=1 18 530 5.0E-15
sp|Q46XW6|CH60_CUPPJ 60 kDa chaperonin OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=groL PE=3 SV=1 22 524 5.0E-15
sp|Q6MF95|CH601_PARUW 60 kDa chaperonin 1 OS=Protochlamydia amoebophila (strain UWE25) GN=groL1 PE=3 SV=1 21 376 5.0E-15
sp|Q6MRI1|CH60_BDEBA 60 kDa chaperonin OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=groL PE=3 SV=1 24 148 5.0E-15
sp|Q8GJ00|CH60_FUSNP 60 kDa chaperonin OS=Fusobacterium nucleatum subsp. polymorphum GN=groL PE=3 SV=1 22 536 6.0E-15
sp|Q747C7|CH60_GEOSL 60 kDa chaperonin OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=groL PE=3 SV=1 21 530 6.0E-15
sp|Q8CX22|CH60_STRA3 60 kDa chaperonin OS=Streptococcus agalactiae serotype III (strain NEM316) GN=groL PE=3 SV=1 18 530 6.0E-15
sp|A0LKS4|CH602_SYNFM 60 kDa chaperonin 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=groL2 PE=3 SV=1 18 530 6.0E-15
sp|A5V0S2|CH602_ROSS1 60 kDa chaperonin 2 OS=Roseiflexus sp. (strain RS-1) GN=groL2 PE=3 SV=1 18 530 6.0E-15
sp|Q13IM9|CH605_BURXL 60 kDa chaperonin 5 OS=Burkholderia xenovorans (strain LB400) GN=groL5 PE=3 SV=1 37 530 6.0E-15
sp|Q9XCA9|CH60_RHOMR 60 kDa chaperonin OS=Rhodothermus marinus GN=groL PE=3 SV=1 37 530 7.0E-15
sp|Q1QDC9|CH60_PSYCK 60 kDa chaperonin OS=Psychrobacter cryohalolentis (strain K5) GN=groL PE=3 SV=1 18 524 7.0E-15
sp|A1WL05|CH60_VEREI 60 kDa chaperonin OS=Verminephrobacter eiseniae (strain EF01-2) GN=groL PE=3 SV=1 22 524 8.0E-15
sp|Q49YY5|CH60_STAS1 60 kDa chaperonin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=groL PE=3 SV=1 18 232 8.0E-15
sp|B1L1K0|CH60_CLOBM 60 kDa chaperonin OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=groL PE=3 SV=1 22 524 8.0E-15
sp|A7GIN3|CH60_CLOBL 60 kDa chaperonin OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=groL PE=3 SV=1 22 524 8.0E-15
sp|B1IFD4|CH60_CLOBK 60 kDa chaperonin OS=Clostridium botulinum (strain Okra / Type B1) GN=groL PE=3 SV=1 22 524 8.0E-15
sp|C1FLV5|CH60_CLOBJ 60 kDa chaperonin OS=Clostridium botulinum (strain Kyoto / Type A2) GN=groL PE=3 SV=1 22 524 8.0E-15
sp|A5I723|CH60_CLOBH 60 kDa chaperonin OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=groL PE=3 SV=1 22 524 8.0E-15
sp|A7FYP3|CH60_CLOB1 60 kDa chaperonin OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=groL PE=3 SV=1 22 524 8.0E-15
sp|A3CKI1|CH60_STRSV 60 kDa chaperonin OS=Streptococcus sanguinis (strain SK36) GN=groL PE=3 SV=1 18 530 8.0E-15
sp|Q8KJ16|CH60_STRSA 60 kDa chaperonin OS=Streptococcus sanguinis GN=groL PE=3 SV=1 18 530 8.0E-15
sp|A9BXL3|CH60_DELAS 60 kDa chaperonin OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=groL PE=3 SV=1 22 530 9.0E-15
sp|Q2SDG0|CH60_HAHCH 60 kDa chaperonin OS=Hahella chejuensis (strain KCTC 2396) GN=groL PE=3 SV=1 18 538 9.0E-15
sp|A0AXY5|CH602_BURCH 60 kDa chaperonin 2 OS=Burkholderia cenocepacia (strain HI2424) GN=groL2 PE=3 SV=1 37 530 1.0E-14
sp|B5YDR9|CH60_DICT6 60 kDa chaperonin OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=groL PE=3 SV=1 37 530 1.0E-14
sp|O02649|CH60_DROME 60 kDa heat shock protein, mitochondrial OS=Drosophila melanogaster GN=Hsp60 PE=1 SV=3 21 505 1.0E-14
sp|C5CPP8|CH60_VARPS 60 kDa chaperonin OS=Variovorax paradoxus (strain S110) GN=groL PE=3 SV=1 22 524 1.0E-14
sp|Q0AVV1|CH60_SYNWW 60 kDa chaperonin OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=groL PE=3 SV=1 18 536 1.0E-14
sp|Q8PW06|CH60_METMA 60 kDa chaperonin OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=groL PE=3 SV=1 18 538 1.0E-14
sp|Q7W134|CH60_BORPA 60 kDa chaperonin OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=groL PE=3 SV=1 18 531 1.0E-14
sp|Q7WNS4|CH60_BORBR 60 kDa chaperonin OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=groL PE=3 SV=1 18 531 1.0E-14
sp|A1K828|CH602_AZOSB 60 kDa chaperonin 2 OS=Azoarcus sp. (strain BH72) GN=groL2 PE=3 SV=1 18 536 1.0E-14
sp|B3R2Y3|CH60_CUPTR 60 kDa chaperonin OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=groL PE=3 SV=1 22 524 1.0E-14
sp|Q0I7U3|CH602_SYNS3 60 kDa chaperonin 2 OS=Synechococcus sp. (strain CC9311) GN=groL2 PE=3 SV=1 37 530 1.0E-14
sp|P48210|CH60_BORPE 60 kDa chaperonin OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=groL PE=3 SV=1 18 531 1.0E-14
sp|B0U418|CH60_XYLFM 60 kDa chaperonin OS=Xylella fastidiosa (strain M12) GN=groL PE=3 SV=1 22 530 2.0E-14
sp|Q4L7R4|CH60_STAHJ 60 kDa chaperonin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=groL PE=3 SV=1 18 235 2.0E-14
sp|Q9AEP7|CH60_LACLM 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=groL PE=3 SV=1 18 530 2.0E-14
sp|Q19NJ4|CH602_ECOK1 60 kDa chaperonin 2 OS=Escherichia coli O1:K1 / APEC GN=groL2 PE=3 SV=1 21 530 2.0E-14
sp|Q8KIX4|CH60_BUCPP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Pterocomma populeum GN=groL PE=3 SV=1 18 524 2.0E-14
sp|Q2IFK0|CH602_ANADE 60 kDa chaperonin 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=groL2 PE=3 SV=1 22 524 2.0E-14
sp|A1AST1|CH60_PELPD 60 kDa chaperonin OS=Pelobacter propionicus (strain DSM 2379) GN=groL PE=3 SV=1 21 530 2.0E-14
sp|Q8Y1P8|CH60_RALSO 60 kDa chaperonin OS=Ralstonia solanacearum (strain GMI1000) GN=groL PE=3 SV=1 22 381 2.0E-14
sp|Q2NBL8|CH601_ERYLH 60 kDa chaperonin 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL1 PE=3 SV=1 18 389 2.0E-14
sp|Q391Y9|CH601_BURL3 60 kDa chaperonin 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=groL1 PE=3 SV=1 37 530 2.0E-14
sp|Q03SQ9|CH60_LACBA 60 kDa chaperonin OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=groL PE=3 SV=1 18 530 3.0E-14
sp|B2UKV8|CH60_AKKM8 60 kDa chaperonin OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=groL PE=3 SV=1 18 530 3.0E-14
sp|Q4QN05|CH60_HAEI8 60 kDa chaperonin OS=Haemophilus influenzae (strain 86-028NP) GN=groL PE=3 SV=1 18 524 3.0E-14
sp|Q031S8|CH60_LACLS 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=groL PE=3 SV=1 18 530 3.0E-14
sp|A5UH48|CH60_HAEIG 60 kDa chaperonin OS=Haemophilus influenzae (strain PittGG) GN=groL PE=3 SV=1 18 230 3.0E-14
sp|A8AZE1|CH60_STRGC 60 kDa chaperonin OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=groL PE=3 SV=1 18 530 3.0E-14
sp|Q73NH7|CH60_TREDE 60 kDa chaperonin OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=groL PE=3 SV=1 18 524 3.0E-14
sp|B2TIX0|CH60_CLOBB 60 kDa chaperonin OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=groL PE=3 SV=1 18 347 4.0E-14
sp|Q4FU94|CH60_PSYA2 60 kDa chaperonin OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=groL PE=3 SV=1 18 524 4.0E-14
sp|P50140|CH60_CAEEL Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans GN=hsp-60 PE=2 SV=2 5 523 4.0E-14
sp|A5U9V2|CH60_HAEIE 60 kDa chaperonin OS=Haemophilus influenzae (strain PittEE) GN=groL PE=3 SV=1 18 230 4.0E-14
sp|A4SZV4|CH60_POLSQ 60 kDa chaperonin OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=groL PE=3 SV=1 22 381 4.0E-14
sp|A6T1E5|CH60_JANMA 60 kDa chaperonin OS=Janthinobacterium sp. (strain Marseille) GN=groL PE=3 SV=1 22 524 4.0E-14
sp|Q8VT58|CH60_STRGN 60 kDa chaperonin OS=Streptococcus gordonii GN=groL PE=3 SV=1 18 530 5.0E-14
sp|A7NIK8|CH601_ROSCS 60 kDa chaperonin 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=groL1 PE=3 SV=1 18 200 5.0E-14
sp|P37282|CH60_LACLA 60 kDa chaperonin OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=groL PE=3 SV=2 18 530 5.0E-14
sp|P46398|CH60_AGGAC 60 kDa chaperonin OS=Aggregatibacter actinomycetemcomitans GN=groL PE=1 SV=3 18 230 5.0E-14
sp|P78012|CH60_MYCPN 60 kDa chaperonin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=groL PE=1 SV=1 22 537 5.0E-14
sp|A5CZ03|CH60_PELTS 60 kDa chaperonin OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=groL PE=3 SV=1 22 530 5.0E-14
sp|Q2KXZ3|CH60_BORA1 60 kDa chaperonin OS=Bordetella avium (strain 197N) GN=groL PE=3 SV=1 18 531 5.0E-14
sp|B4SKL8|CH60_STRM5 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3) GN=groL PE=3 SV=1 21 145 5.0E-14
sp|P30717|CH60_CLOAB 60 kDa chaperonin OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=groL PE=3 SV=1 22 524 5.0E-14
sp|Q8KJ20|CH60_STRAP 60 kDa chaperonin OS=Streptococcus anginosus GN=groL PE=3 SV=1 18 530 5.0E-14
sp|Q7NQX1|CH602_CHRVO 60 kDa chaperonin 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL2 PE=3 SV=1 18 530 5.0E-14
sp|Q1AXU6|CH60_RUBXD 60 kDa chaperonin OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=groL PE=3 SV=1 18 530 6.0E-14
sp|A1R074|CH60_BORT9 60 kDa chaperonin OS=Borrelia turicatae (strain 91E135) GN=groL PE=3 SV=1 22 524 6.0E-14
sp|A5W8M6|CH60_PSEP1 60 kDa chaperonin OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=groL PE=3 SV=1 18 145 6.0E-14
sp|B0KFQ2|CH60_PSEPG 60 kDa chaperonin OS=Pseudomonas putida (strain GB-1) GN=groL PE=3 SV=1 18 145 6.0E-14
sp|Q88N55|CH60_PSEPK 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1 18 145 7.0E-14
sp|P37578|CH601_MYCLE 60 kDa chaperonin 1 OS=Mycobacterium leprae (strain TN) GN=groL1 PE=3 SV=1 37 531 7.0E-14
sp|Q2T3W7|CH602_BURTA 60 kDa chaperonin 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL2 PE=3 SV=1 37 530 7.0E-14
sp|B1J3K5|CH60_PSEPW 60 kDa chaperonin OS=Pseudomonas putida (strain W619) GN=groL PE=3 SV=1 18 145 7.0E-14
sp|A0Q2T1|CH60_CLONN 60 kDa chaperonin OS=Clostridium novyi (strain NT) GN=groL PE=3 SV=1 22 530 7.0E-14
sp|B0TX65|CH60_FRAP2 60 kDa chaperonin OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=groL PE=3 SV=1 18 524 7.0E-14
sp|B1XXY9|CH60_LEPCP 60 kDa chaperonin OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=groL PE=3 SV=1 22 346 8.0E-14
sp|A6QBP8|CH60_SULNB 60 kDa chaperonin OS=Sulfurovum sp. (strain NBC37-1) GN=groL PE=3 SV=1 22 524 8.0E-14
sp|C1CZP1|CH60_DEIDV 60 kDa chaperonin OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=groL PE=3 SV=1 18 530 9.0E-14
sp|P94820|CH60_HOLOB 60 kDa chaperonin OS=Holospora obtusa GN=groL PE=3 SV=1 18 538 9.0E-14
sp|Q8CX48|CH60_SHEON 60 kDa chaperonin OS=Shewanella oneidensis (strain MR-1) GN=groL PE=3 SV=1 22 524 9.0E-14
sp|Q1I5E2|CH60_PSEE4 60 kDa chaperonin OS=Pseudomonas entomophila (strain L48) GN=groL PE=3 SV=1 18 145 9.0E-14
sp|A3QA46|CH60_SHELP 60 kDa chaperonin OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=groL PE=3 SV=1 18 524 1.0E-13
sp|Q05FT9|CH60_CARRP 60 kDa chaperonin OS=Carsonella ruddii (strain PV) GN=groL PE=3 SV=1 16 536 1.0E-13
sp|C4K477|CH60_HAMD5 60 kDa chaperonin OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=groL PE=3 SV=1 18 524 1.0E-13
sp|Q2NIM6|CH60_AYWBP 60 kDa chaperonin OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=groL PE=3 SV=1 18 357 1.0E-13
sp|P43733|CH60_HAEIN 60 kDa chaperonin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=groL PE=3 SV=1 18 230 1.0E-13
sp|B2UZ02|CH60_CLOBA 60 kDa chaperonin OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=groL PE=3 SV=1 18 312 1.0E-13
sp|B5RPZ1|CH60_BORRA 60 kDa chaperonin OS=Borrelia recurrentis (strain A1) GN=groL PE=3 SV=1 22 524 1.0E-13
sp|B5RMJ5|CH60_BORDL 60 kDa chaperonin OS=Borrelia duttonii (strain Ly) GN=groL PE=3 SV=1 22 524 1.0E-13
sp|Q8KJ24|CH60_CLOBO 60 kDa chaperonin OS=Clostridium botulinum GN=groL PE=3 SV=1 22 530 1.0E-13
sp|B2V8F1|CH60_SULSY 60 kDa chaperonin OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=groL PE=3 SV=1 18 148 1.0E-13
sp|A0LEH2|CH601_SYNFM 60 kDa chaperonin 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=groL1 PE=3 SV=1 37 505 1.0E-13
sp|Q93GW2|CH60_CAMRE 60 kDa chaperonin OS=Campylobacter rectus GN=groL PE=3 SV=1 22 530 1.0E-13
sp|O66190|CH60_ENTAS 60 kDa chaperonin (Fragment) OS=Enterobacter asburiae GN=groL PE=3 SV=1 18 524 1.0E-13
sp|B2G5X7|CH60_LACRJ 60 kDa chaperonin OS=Lactobacillus reuteri (strain JCM 1112) GN=groL PE=3 SV=1 18 537 1.0E-13
sp|A5VIE9|CH60_LACRD 60 kDa chaperonin OS=Lactobacillus reuteri (strain DSM 20016) GN=groL PE=3 SV=1 18 537 1.0E-13
sp|A4J8H4|CH60_DESRM 60 kDa chaperonin OS=Desulfotomaculum reducens (strain MI-1) GN=groL PE=3 SV=1 37 530 1.0E-13
sp|Q21ZD1|CH601_RHOFT 60 kDa chaperonin 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=groL1 PE=3 SV=1 22 524 1.0E-13
sp|P48216|CH60_PSEPU 60 kDa chaperonin OS=Pseudomonas putida GN=groL PE=1 SV=3 18 145 1.0E-13
sp|B5YJN3|CH60_THEYD 60 kDa chaperonin OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=groL PE=3 SV=1 22 538 2.0E-13
sp|A7I798|CH60_METB6 60 kDa chaperonin OS=Methanoregula boonei (strain 6A8) GN=groL PE=3 SV=1 16 353 2.0E-13
sp|Q6YR94|CH60_ONYPE 60 kDa chaperonin OS=Onion yellows phytoplasma (strain OY-M) GN=groL PE=3 SV=1 18 357 2.0E-13
sp|Q59687|CH60_PASMU 60 kDa chaperonin OS=Pasteurella multocida (strain Pm70) GN=groL PE=3 SV=2 18 230 2.0E-13
sp|O33500|CH60_PSEST 60 kDa chaperonin OS=Pseudomonas stutzeri GN=groL PE=3 SV=1 18 145 2.0E-13
sp|Q08854|CH60_STAAU 60 kDa chaperonin OS=Staphylococcus aureus GN=groL PE=1 SV=3 18 201 2.0E-13
sp|A0KGL1|CH60_AERHH 60 kDa chaperonin OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=groL PE=3 SV=1 18 206 2.0E-13
sp|B2A5V3|CH60_NATTJ 60 kDa chaperonin OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=groL PE=3 SV=1 37 530 2.0E-13
sp|B4S112|CH60_ALTMD 60 kDa chaperonin OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=groL PE=3 SV=1 18 524 2.0E-13
sp|P95647|CH602_RHOSH 60 kDa chaperonin 2 OS=Rhodobacter sphaeroides GN=groL2 PE=3 SV=1 18 248 2.0E-13
sp|Q3ADX3|CH60_CARHZ 60 kDa chaperonin OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=groL PE=3 SV=1 37 530 2.0E-13
sp|A1KW52|CH60_NEIMF 60 kDa chaperonin OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=groL PE=3 SV=1 18 530 2.0E-13
sp|P57006|CH60_NEIMA 60 kDa chaperonin OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=groL PE=3 SV=1 18 530 2.0E-13
sp|O66210|CH60_KLEOX 60 kDa chaperonin (Fragment) OS=Klebsiella oxytoca GN=groL PE=3 SV=1 18 524 3.0E-13
sp|A1SYD3|CH603_PSYIN 60 kDa chaperonin 3 OS=Psychromonas ingrahamii (strain 37) GN=groL3 PE=3 SV=1 18 538 3.0E-13
sp|A1K436|CH601_AZOSB 60 kDa chaperonin 1 OS=Azoarcus sp. (strain BH72) GN=groL1 PE=3 SV=1 18 345 3.0E-13
sp|O66200|CH60_ENTAG 60 kDa chaperonin (Fragment) OS=Enterobacter agglomerans GN=groL PE=3 SV=1 18 524 3.0E-13
sp|P26821|CH60_CLOPE 60 kDa chaperonin OS=Clostridium perfringens (strain 13 / Type A) GN=groL PE=3 SV=2 22 206 3.0E-13
sp|B9DW28|CH60_STRU0 60 kDa chaperonin OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=groL PE=3 SV=1 18 530 3.0E-13
sp|Q0TN27|CH60_CLOP1 60 kDa chaperonin OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=groL PE=3 SV=1 22 206 3.0E-13
sp|Q7UM99|CH601_RHOBA 60 kDa chaperonin 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=groL1 PE=3 SV=2 22 462 3.0E-13
sp|Q0VRW6|CH60_ALCBS 60 kDa chaperonin OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=groL PE=3 SV=1 22 537 3.0E-13
sp|A9M0Q6|CH60_NEIM0 60 kDa chaperonin OS=Neisseria meningitidis serogroup C (strain 053442) GN=groL PE=3 SV=1 18 530 3.0E-13
sp|Q3IW60|CH602_RHOS4 60 kDa chaperonin 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=groL2 PE=3 SV=1 18 248 3.0E-13
sp|O66214|CH60_RAOOR 60 kDa chaperonin (Fragment) OS=Raoultella ornithinolytica GN=groL PE=3 SV=1 18 524 3.0E-13
sp|Q052X9|CH60_LEPBL 60 kDa chaperonin OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=groL PE=3 SV=1 24 524 3.0E-13
sp|Q04S01|CH60_LEPBJ 60 kDa chaperonin OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=groL PE=3 SV=1 24 524 3.0E-13
sp|A6H125|CH60_FLAPJ 60 kDa chaperonin OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=groL PE=3 SV=1 37 537 4.0E-13
sp|Q3AHM4|CH602_SYNSC 60 kDa chaperonin 2 OS=Synechococcus sp. (strain CC9605) GN=groL2 PE=3 SV=1 41 530 4.0E-13
sp|Q7MBC7|CH601_GLOVI 60 kDa chaperonin 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=groL1 PE=3 SV=1 37 531 4.0E-13
sp|Q3AZK3|CH601_SYNS9 60 kDa chaperonin 1 OS=Synechococcus sp. (strain CC9902) GN=groL1 PE=3 SV=1 37 530 4.0E-13
sp|P0C0N7|CH60_STAES 60 kDa chaperonin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=groL PE=3 SV=2 18 232 4.0E-13
sp|Q5HMZ1|CH60_STAEQ 60 kDa chaperonin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=groL PE=3 SV=1 18 232 4.0E-13
sp|Q12FH7|CH60_POLSJ 60 kDa chaperonin OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=groL PE=3 SV=1 22 524 4.0E-13
sp|B1XRX1|CH60_POLNS 60 kDa chaperonin OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=groL PE=3 SV=1 22 381 4.0E-13
sp|B0SKU2|CH60_LEPBP 60 kDa chaperonin OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=groL PE=3 SV=1 18 524 4.0E-13
sp|B0SCC0|CH60_LEPBA 60 kDa chaperonin OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=groL PE=3 SV=1 18 524 4.0E-13
sp|Q7TTX1|CH601_SYNPX 60 kDa chaperonin 1 OS=Synechococcus sp. (strain WH8102) GN=groL1 PE=3 SV=1 37 530 4.0E-13
sp|P42385|CH60_NEIMB 60 kDa chaperonin OS=Neisseria meningitidis serogroup B (strain MC58) GN=groL PE=1 SV=2 18 530 4.0E-13
sp|Q47IZ8|CH60_DECAR 60 kDa chaperonin OS=Dechloromonas aromatica (strain RCB) GN=groL PE=3 SV=1 18 524 4.0E-13
sp|B8F865|CH60_HAEPS 60 kDa chaperonin OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=groL PE=3 SV=1 18 524 5.0E-13
sp|Q2IKI2|CH601_ANADE 60 kDa chaperonin 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=groL1 PE=3 SV=1 18 530 5.0E-13
sp|Q1D2S1|CH602_MYXXD 60 kDa chaperonin 2 OS=Myxococcus xanthus (strain DK 1622) GN=groL2 PE=3 SV=1 37 530 5.0E-13
sp|A6UNR2|CH60_METVS 60 kDa chaperonin OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=groL PE=3 SV=1 21 531 5.0E-13
sp|P61438|CH60_LEPIC 60 kDa chaperonin OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=groL PE=2 SV=1 24 524 5.0E-13
sp|Q98IV5|CH601_RHILO 60 kDa chaperonin 1 OS=Rhizobium loti (strain MAFF303099) GN=groL1 PE=3 SV=1 18 530 6.0E-13
sp|A8ILV4|CH601_AZOC5 60 kDa chaperonin 1 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=groL1 PE=3 SV=1 18 530 6.0E-13
sp|B8D6T6|CH60_BUCAT 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=groL PE=3 SV=1 21 524 6.0E-13
sp|Q0HZ97|CH60_SHESR 60 kDa chaperonin OS=Shewanella sp. (strain MR-7) GN=groL PE=3 SV=1 22 524 6.0E-13
sp|Q0HEQ4|CH60_SHESM 60 kDa chaperonin OS=Shewanella sp. (strain MR-4) GN=groL PE=3 SV=1 22 524 6.0E-13
sp|B0TVL3|CH60_SHEHH 60 kDa chaperonin OS=Shewanella halifaxensis (strain HAW-EB4) GN=groL PE=3 SV=1 18 524 6.0E-13
sp|C4L1L2|CH60_EXISA 60 kDa chaperonin OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=groL PE=3 SV=1 21 530 6.0E-13
sp|A8ERY3|CH60_ARCB4 60 kDa chaperonin OS=Arcobacter butzleri (strain RM4018) GN=groL PE=3 SV=1 37 524 6.0E-13
sp|P25750|CH60_BUCAI 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=groL PE=3 SV=1 18 524 7.0E-13
sp|B8D8I2|CH60_BUCA5 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=groL PE=3 SV=1 18 524 7.0E-13
sp|A0L170|CH60_SHESA 60 kDa chaperonin OS=Shewanella sp. (strain ANA-3) GN=groL PE=3 SV=1 22 524 7.0E-13
sp|Q5F541|CH60_NEIG1 60 kDa chaperonin OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=groL PE=3 SV=1 18 530 7.0E-13
sp|B1KIR6|CH60_SHEWM 60 kDa chaperonin OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=groL PE=3 SV=1 18 524 7.0E-13
sp|P61439|CH60_LEPIN 60 kDa chaperonin OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=groL PE=3 SV=1 24 524 7.0E-13
sp|B4RRA1|CH60_NEIG2 60 kDa chaperonin OS=Neisseria gonorrhoeae (strain NCCP11945) GN=groL PE=3 SV=1 18 530 7.0E-13
sp|A5EET6|CH602_BRASB 60 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL2 PE=3 SV=1 21 531 7.0E-13
sp|Q3SMK1|CH60_THIDA 60 kDa chaperonin OS=Thiobacillus denitrificans (strain ATCC 25259) GN=groL PE=3 SV=1 18 427 7.0E-13
sp|A6VM38|CH60_ACTSZ 60 kDa chaperonin OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=groL PE=3 SV=1 18 230 7.0E-13
sp|Q5QVT4|CH60_IDILO 60 kDa chaperonin OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=groL PE=3 SV=1 18 530 8.0E-13
sp|B9L698|CH60_NAUPA 60 kDa chaperonin OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=groL PE=3 SV=1 24 524 8.0E-13
sp|Q1LQS4|CH60_CUPMC 60 kDa chaperonin OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=groL PE=3 SV=1 22 376 8.0E-13
sp|A4G837|CH60_HERAR 60 kDa chaperonin OS=Herminiimonas arsenicoxydans GN=groL PE=3 SV=1 22 536 9.0E-13
sp|A5EX17|CH60_DICNV 60 kDa chaperonin OS=Dichelobacter nodosus (strain VCS1703A) GN=groL PE=3 SV=1 18 530 9.0E-13
sp|Q12S61|CH60_SHEDO 60 kDa chaperonin OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=groL PE=3 SV=1 18 530 9.0E-13
sp|Q87BC0|CH60_XYLFT 60 kDa chaperonin OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=groL PE=3 SV=1 22 230 9.0E-13
sp|B2I7D4|CH60_XYLF2 60 kDa chaperonin OS=Xylella fastidiosa (strain M23) GN=groL PE=3 SV=1 22 230 9.0E-13
sp|Q0T9P8|CH60_ECOL5 60 kDa chaperonin OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=groL PE=3 SV=1 18 538 9.0E-13
sp|Q8CWW6|CH60_STRMU 60 kDa chaperonin OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=groL PE=3 SV=1 18 530 9.0E-13
sp|Q9PFP2|CH60_XYLFA 60 kDa chaperonin OS=Xylella fastidiosa (strain 9a5c) GN=groL PE=3 SV=1 22 230 9.0E-13
sp|A8H8W3|CH60_SHEPA 60 kDa chaperonin OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=groL PE=3 SV=1 18 152 9.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10438
MKDEQGRPFIIVRDQGKKKRQFGNEAVKSHILAARTVANLVKSSLGPRGLDKILISPDGDITVTNDGATIMQQME
ISNHVAKLLVELSKSQDDEIGDGTTGVVVLAGALLEQAADLIDKGIHPIRIADGYDQACDIAIAELDNISDTVDF
TKKETSNLVKVARTSLGSKIVSKAHDQFANIAVDAVLSVADLERKDVDFELIKVDGKVGGSLEDTLLVKGVVVDK
DFSHPQMPSEIRDAKIAILTCAFEPPKPKTKHHLDITSVEEFKKLQNYEREKFIEMIQQIKDTGANLAICQWGFD
DEANHLLLQNKLPAVRWVGGPEIELIAIATNGRIVPRFEDLKAEKLGTAGVVREMTFGTTREKMLVIEECANTRA
VTVFVRGSNKMIIDEAKRSLHDALCVVRNLVRDNRVVYGGGAAEIACSLAVEDAAVKTPGLEQYAMRAFSEALDA
VPMALAENSGLNPISTLAEVKSQQVKAGPGGKGKLGVDCMGCGSNNMKDAFVIDPLIGKKQQLQLATQLCRMVLK
VNNVIVSGVDENDF*
Coding >Hirsu2|10438
ATGAAGGATGAGCAAGGCCGTCCCTTCATCATCGTCCGAGATCAGGGGAAGAAGAAGCGGCAGTTTGGCAACGAG
GCTGTCAAGTCGCACATTCTGGCAGCTCGAACAGTAGCGAACCTCGTCAAATCCTCTCTCGGACCACGAGGCCTC
GACAAGATCCTCATCTCCCCCGATGGCGATATTACTGTGACCAACGACGGAGCGACCATCATGCAGCAGATGGAA
ATCAGCAACCACGTTGCTAAGCTCCTCGTCGAGCTTTCCAAGTCGCAGGACGATGAAATTGGTGACGGCACAACG
GGCGTTGTCGTCTTGGCCGGTGCGCTGCTTGAGCAGGCAGCCGACTTGATTGACAAAGGCATCCACCCCATCCGG
ATTGCCGATGGCTACGACCAGGCTTGCGACATCGCCATCGCAGAGCTGGACAACATCTCGGATACTGTCGACTTC
ACCAAGAAGGAGACGTCCAACCTCGTCAAGGTAGCGCGGACCAGCCTGGGCAGCAAGATCGTCTCCAAGGCCCAC
GATCAATTTGCCAACATTGCCGTCGATGCCGTCCTTTCCGTAGCAGACCTGGAGCGCAAAGATGTCGACTTTGAG
CTCATCAAGGTCGACGGCAAGGTTGGCGGGTCCTTGGAAGACACGCTGCTCGTCAAGGGTGTCGTGGTCGACAAG
GACTTTTCTCACCCACAGATGCCGTCGGAAATTCGAGACGCCAAAATCGCCATCCTCACGTGTGCCTTCGAGCCG
CCGAAACCTAAGACGAAACACCATCTCGACATCACCAGCGTTGAGGAGTTCAAGAAGCTGCAAAACTATGAGAGG
GAGAAGTTCATCGAGATGATTCAGCAGATCAAGGACACGGGAGCCAACCTGGCCATTTGCCAGTGGGGATTCGAC
GACGAGGCGAATCACCTTTTGCTTCAGAACAAGCTCCCGGCCGTCCGGTGGGTTGGCGGGCCCGAGATCGAGCTG
ATCGCCATTGCCACCAACGGACGGATAGTTCCGCGTTTCGAGGACCTGAAGGCGGAGAAACTCGGCACTGCCGGT
GTCGTGAGGGAGATGACGTTTGGCACGACGAGGGAGAAGATGCTGGTCATCGAAGAATGCGCCAACACGCGGGCT
GTGACGGTGTTCGTTCGTGGGAGCAACAAGATGATCATTGACGAGGCGAAGAGGTCTCTGCACGACGCTCTCTGT
GTCGTGCGAAACCTGGTGCGCGACAACCGAGTAGTCTACGGCGGCGGCGCTGCTGAGATTGCCTGCTCGCTCGCC
GTCGAGGACGCGGCCGTCAAGACGCCAGGCCTGGAGCAGTACGCCATGCGCGCCTTCTCCGAGGCGCTAGATGCC
GTGCCCATGGCTCTGGCAGAAAACAGCGGCCTGAATCCCATTTCGACGCTGGCCGAGGTGAAGAGCCAGCAGGTC
AAGGCGGGGCCTGGCGGCAAGGGCAAGCTGGGCGTCGACTGCATGGGGTGCGGCAGCAACAACATGAAGGATGCC
TTTGTCATCGATCCCCTGATCGGCAAGAAGCAGCAGCTGCAACTGGCCACGCAATTATGTCGGATGGTTCTGAAG
GTGAACAACGTCATCGTGTCCGGGGTAGATGAAAACGACTTTTAG
Transcript >Hirsu2|10438
ATGAAGGATGAGCAAGGCCGTCCCTTCATCATCGTCCGAGATCAGGGGAAGAAGAAGCGGCAGTTTGGCAACGAG
GCTGTCAAGTCGCACATTCTGGCAGCTCGAACAGTAGCGAACCTCGTCAAATCCTCTCTCGGACCACGAGGCCTC
GACAAGATCCTCATCTCCCCCGATGGCGATATTACTGTGACCAACGACGGAGCGACCATCATGCAGCAGATGGAA
ATCAGCAACCACGTTGCTAAGCTCCTCGTCGAGCTTTCCAAGTCGCAGGACGATGAAATTGGTGACGGCACAACG
GGCGTTGTCGTCTTGGCCGGTGCGCTGCTTGAGCAGGCAGCCGACTTGATTGACAAAGGCATCCACCCCATCCGG
ATTGCCGATGGCTACGACCAGGCTTGCGACATCGCCATCGCAGAGCTGGACAACATCTCGGATACTGTCGACTTC
ACCAAGAAGGAGACGTCCAACCTCGTCAAGGTAGCGCGGACCAGCCTGGGCAGCAAGATCGTCTCCAAGGCCCAC
GATCAATTTGCCAACATTGCCGTCGATGCCGTCCTTTCCGTAGCAGACCTGGAGCGCAAAGATGTCGACTTTGAG
CTCATCAAGGTCGACGGCAAGGTTGGCGGGTCCTTGGAAGACACGCTGCTCGTCAAGGGTGTCGTGGTCGACAAG
GACTTTTCTCACCCACAGATGCCGTCGGAAATTCGAGACGCCAAAATCGCCATCCTCACGTGTGCCTTCGAGCCG
CCGAAACCTAAGACGAAACACCATCTCGACATCACCAGCGTTGAGGAGTTCAAGAAGCTGCAAAACTATGAGAGG
GAGAAGTTCATCGAGATGATTCAGCAGATCAAGGACACGGGAGCCAACCTGGCCATTTGCCAGTGGGGATTCGAC
GACGAGGCGAATCACCTTTTGCTTCAGAACAAGCTCCCGGCCGTCCGGTGGGTTGGCGGGCCCGAGATCGAGCTG
ATCGCCATTGCCACCAACGGACGGATAGTTCCGCGTTTCGAGGACCTGAAGGCGGAGAAACTCGGCACTGCCGGT
GTCGTGAGGGAGATGACGTTTGGCACGACGAGGGAGAAGATGCTGGTCATCGAAGAATGCGCCAACACGCGGGCT
GTGACGGTGTTCGTTCGTGGGAGCAACAAGATGATCATTGACGAGGCGAAGAGGTCTCTGCACGACGCTCTCTGT
GTCGTGCGAAACCTGGTGCGCGACAACCGAGTAGTCTACGGCGGCGGCGCTGCTGAGATTGCCTGCTCGCTCGCC
GTCGAGGACGCGGCCGTCAAGACGCCAGGCCTGGAGCAGTACGCCATGCGCGCCTTCTCCGAGGCGCTAGATGCC
GTGCCCATGGCTCTGGCAGAAAACAGCGGCCTGAATCCCATTTCGACGCTGGCCGAGGTGAAGAGCCAGCAGGTC
AAGGCGGGGCCTGGCGGCAAGGGCAAGCTGGGCGTCGACTGCATGGGGTGCGGCAGCAACAACATGAAGGATGCC
TTTGTCATCGATCCCCTGATCGGCAAGAAGCAGCAGCTGCAACTGGCCACGCAATTATGTCGGATGGTTCTGAAG
GTGAACAACGTCATCGTGTCCGGGGTAGATGAAAACGACTTTTAG
Gene >Hirsu2|10438
ATGAAGGATGAGCAAGGCCGTCCCTTCATCATCGTCCGAGAGTGCGTGGACCCTCCCCATCTGCCGGAGCGGCGC
GGGAAATACTGATCCGTTACGCGCAGTCAGGGGAAGAAGAAGCGGCAGTTTGGCAACGAGGCTGTCAAGTCGCAC
ATTCTGGCAGCTCGAACAGTAGCGAACCTCGTCAAATCCTCTCTCGGACCACGAGGCCTCGACAAGATCCTCATC
TCCCCCGATGGCGATATTACTGTGACCAACGACGGAGCGACCATCATGCAGCAGATGGAAATCAGCAACCACGTT
GCTAAGCTCCTCGTCGAGCTTTCCAAGTCGCAGGACGATGAAATTGGTGACGGCACAACGGGCGTTGTCGTCTTG
GCCGGTGCGCTGCTTGAGCAGGCAGCCGACTTGATTGACAAAGGCATCCACCCCATCCGGATTGCCGATGGCTAC
GACCAGGCTTGCGACATCGCCATCGCAGAGCTGGACAACATCTCGGATACTGTCGACTTCACCAAGAAGGAGACG
TCCAACCTCGTCAAGGTAGCGCGGACCAGCCTGGGCAGCAAGATCGTCTCCAAGGCCCACGATCAATTTGCCAAC
ATTGCCGTCGATGCCGTCCTTTCCGTAGCAGACCTGGAGCGCAAAGATGTCGACTTTGAGCTCATCAAGGTCGAC
GGCAAGGTTGGCGGGTCCTTGGAAGACACGCTGCTCGTCAAGGGTGTCGTGGTCGACAAGGACTTTTCTCACCCA
CAGATGCCGTCGGAAATTCGAGACGCCAAAATCGCCATCCTCACGTGTGCCTTCGAGCCGCCGAAACCTAAGACG
AAACACCATCTCGACATCACCAGCGTTGAGGAGTTCAAGAAGCTGCAAAACTATGAGAGGGAGAAGTTCATCGAG
ATGATTCAGCAGATCAAGGACACGGGAGCCAACCTGGCCATTTGCCAGTGGGGATTCGACGACGAGGCGAATCAC
CTTTTGCTTCAGAACAAGCTCCCGGCCGTCCGGTGGGTTGGCGGGCCCGAGATCGAGCTGATCGCCATTGCCACC
AACGGACGGATAGTTCCGCGTTTCGAGGACCTGAAGGCGGAGAAACTCGGCACTGCCGGTGTCGTGAGGGAGATG
ACGTTTGGCACGACGAGGGAGAAGATGCTGGTCATCGAAGAATGCGCCAACACGCGGGCTGTGACGGTGTTCGTT
CGTGGGAGCAACAAGATGGTCAGTGACGACGGCTCACGTTGCCTCACCCAGGCCGCGCACCCCTCGTCGCCTTGC
TAACATGGGCCCCCACAGATCATTGACGAGGCGAAGAGGTCTCTGCACGACGCTCTCTGTGTCGTGCGAAACCTG
GTGCGCGACAACCGAGTAGTCTACGGCGGCGGCGCTGCTGAGATTGCCTGCTCGCTCGCCGTCGAGGACGCGGCC
GTCAAGACGCCAGGCCTGGAGCAGTACGCCATGCGCGCCTTCTCCGAGGCGCTAGATGCCGTGCCCATGGCTCTG
GCAGAAAACAGCGGCCTGAATCCCATTTCGACGCTGGCCGAGGTGAAGAGCCAGCAGGTCAAGGCGGGGCCTGGC
GGCAAGGGCAAGCTGGGCGTCGACTGCATGGGGTGCGGCAGCAACAACATGAAGGATGCCTTTGTCATCGATCCC
CTGATCGGCAAGAAGCAGCAGCTGCAACTGGCCACGCAATTATGTCGGATGGTTCTGAAGGTGAACAACGTCATC
GTGTCCGGGGTAGATGAAAACGACTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail