Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10437
Gene name
LocationContig_843:2187..4776
Strand-
Gene length (bp)2589
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 2.4E-46 153 365
PF08938 HBS1_N HBS1 N-terminus 1.8E-25 10 85
PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain 2.3E-09 495 559
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 7.2E-09 394 460
PF01926 MMR_HSR1 50S ribosome-binding GTPase 4.5E-06 156 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 151 560 2.0E-119
sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 151 560 2.0E-119
sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 151 560 4.0E-114
sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 151 560 8.0E-114
sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 151 560 2.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 151 560 2.0E-119
sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 151 560 2.0E-119
sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 151 560 4.0E-114
sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 151 560 8.0E-114
sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 151 560 2.0E-113
sp|O74774|HBS1_SCHPO Elongation factor 1 alpha-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hbs1 PE=1 SV=4 52 561 5.0E-103
sp|A8ABM5|EF1A_IGNH4 Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 151 560 3.0E-95
sp|P32769|HBS1_YEAST Elongation factor 1 alpha-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBS1 PE=1 SV=2 155 558 8.0E-95
sp|A8MAJ1|EF1A_CALMQ Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 139 558 4.0E-94
sp|P90519|EF1A_CRYPV Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1 148 561 1.0E-93
sp|Q00251|EF1A_AURPU Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 148 561 3.0E-92
sp|A1RXW9|EF1A_THEPD Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 151 560 1.0E-90
sp|A3MV69|EF1A_PYRCJ Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 151 558 3.0E-90
sp|P40911|EF1A_AJECG Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 151 561 3.0E-90
sp|Q59QD6|EF1A2_CANAL Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 148 561 7.0E-90
sp|P0CY35|EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 148 561 8.0E-90
sp|A1RRJ3|EF1A_PYRIL Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 133 558 9.0E-90
sp|Q96WZ1|EF1A_COCIM Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 151 561 1.0E-89
sp|P41745|EF1A_BLAAD Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 148 561 4.0E-89
sp|A5DPE3|EF1A_PICGU Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 148 561 6.0E-89
sp|Q00080|EF1A_PLAFK Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1 148 560 3.0E-88
sp|Q3IUD8|EF1A_NATPD Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 151 558 4.0E-88
sp|P14963|EF1A_EUGGR Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 148 542 5.0E-88
sp|A0RUM4|EF1A_CENSY Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 151 561 6.0E-88
sp|O93729|EF1A_PYRAE Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 133 558 6.0E-88
sp|P86939|EF1A2_TRYB2 Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 148 561 6.0E-88
sp|P86934|EF1A1_TRYB2 Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 148 561 6.0E-88
sp|P50256|EF1AC_PORPU Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 148 561 1.0E-87
sp|Q01520|EF1A_PODAS Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 151 561 1.0E-87
sp|Q8LPC4|EF1A_PYRYE Elongation factor 1-alpha OS=Pyropia yezoensis PE=2 SV=1 148 561 1.0E-87
sp|Q8TRC4|EF1A_METAC Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 151 560 1.0E-87
sp|Q01765|EF1A_PODCU Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 151 561 2.0E-87
sp|A3DMQ1|EF1A_STAMF Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 151 560 2.0E-87
sp|P14864|EF1A2_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-2 PE=3 SV=1 148 561 4.0E-87
sp|P0CT55|EF1A3_SCHPO Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 148 561 4.0E-87
sp|P0CT54|EF1A2_SCHPO Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 148 561 4.0E-87
sp|Q18EY5|EF1A_HALWD Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 151 558 5.0E-87
sp|P28295|EF1A_ABSGL Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 148 561 6.0E-87
sp|Q01372|EF1A_NEUCR Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 151 561 6.0E-87
sp|A4WKK8|EF1A_PYRAR Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 151 558 9.0E-87
sp|P0CT32|EF1A2_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 148 561 9.0E-87
sp|P0CT31|EF1A1_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 148 561 9.0E-87
sp|P0CT53|EF1A1_SCHPO Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 148 561 9.0E-87
sp|P06805|EF1A1_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-1 PE=3 SV=1 148 561 1.0E-86
sp|P31018|EF1A_ENTHI Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1 151 561 1.0E-86
sp|P41203|EF1A_DESMO Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 151 558 1.0E-86
sp|P0CN30|EF1A_CRYNJ Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEF1 PE=3 SV=1 148 561 1.0E-86
sp|P0CN31|EF1A_CRYNB Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEF1 PE=2 SV=1 148 561 1.0E-86
sp|B8GIQ3|EF1A_METPE Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 151 560 1.0E-86
sp|A2BN41|EF1A_HYPBU Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 151 560 2.0E-86
sp|Q9YAV0|EF1A_AERPE Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 151 533 3.0E-86
sp|P86933|EF1A_TRYBB Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 148 561 3.0E-86
sp|P16018|EF1A_HALMA Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 151 558 4.0E-86
sp|P14865|EF1A3_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-3 PE=3 SV=1 148 561 5.0E-86
sp|Q9Y713|EF1A_ASPOR Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 151 561 8.0E-86
sp|Q04634|EF1A_TETPY Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 151 561 8.0E-86
sp|O59949|EF1A_YARLI Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 148 561 1.0E-85
sp|P34825|EF1A_HYPJE Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 151 561 1.0E-85
sp|Q09069|EF1A_SORMA Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 151 561 1.0E-85
sp|P35021|EF1A_SULSO Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 151 560 3.0E-85
sp|Q6L202|EF1A_PICTO Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 151 558 3.0E-85
sp|P41752|EF1A_ASHGO Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 148 561 6.0E-85
sp|P32186|EF1A_PUCGR Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 148 561 8.0E-85
sp|A4YCR6|EF1A_METS5 Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 151 560 1.0E-84
sp|O42820|EF1A_SCHCO Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 148 561 1.0E-84
sp|P19486|EF1A_THEAC Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 151 558 2.0E-84
sp|Q27139|EF1A1_EUPCR Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1 148 561 2.0E-84
sp|P02994|EF1A_YEAST Elongation factor 1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF1 PE=1 SV=1 148 561 3.0E-84
sp|Q9HDF6|EF1A_PIRIN Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 148 561 6.0E-84
sp|A7I656|EF1A_METB6 Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 151 560 1.0E-83
sp|Q149F3|ERF3B_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus GN=Gspt2 PE=1 SV=1 151 558 1.0E-83
sp|Q9HM89|EF1A_HALSA Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 151 558 2.0E-83
sp|B0R8C3|EF1A_HALS3 Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 151 558 2.0E-83
sp|P43643|EF1A_TOBAC Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 148 561 2.0E-83
sp|P54959|EF1A_BLAHO Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1 148 561 3.0E-83
sp|P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens GN=GSPT1 PE=1 SV=1 151 558 4.0E-83
sp|P17786|EF1A_SOLLC Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 148 561 4.0E-83
sp|P34823|EF1A2_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 148 561 5.0E-83
sp|O64937|EF1A_ORYSJ Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 148 561 8.0E-83
sp|P17196|EF1A_SULAC Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 151 560 9.0E-83
sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2 151 558 9.0E-83
sp|Q8GTY0|EF1A4_ARATH Elongation factor 1-alpha 4 OS=Arabidopsis thaliana GN=A4 PE=1 SV=2 148 561 1.0E-82
sp|Q0WL56|EF1A3_ARATH Elongation factor 1-alpha 3 OS=Arabidopsis thaliana GN=A3 PE=1 SV=2 148 561 1.0E-82
sp|Q8W4H7|EF1A2_ARATH Elongation factor 1-alpha 2 OS=Arabidopsis thaliana GN=A2 PE=1 SV=2 148 561 1.0E-82
sp|P0DH99|EF1A1_ARATH Elongation factor 1-alpha 1 OS=Arabidopsis thaliana GN=A1 PE=1 SV=1 148 561 1.0E-82
sp|Q5R4B3|ERF3B_PONAB Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1 151 558 2.0E-82
sp|Q57770|EF1A_METJA Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 159 559 2.0E-82
sp|P53013|EF1A_CAEEL Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=3 SV=1 148 561 2.0E-82
sp|A2STF0|EF1A_METLZ Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 151 560 2.0E-82
sp|Q979T1|EF1A_THEVO Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 151 558 2.0E-82
sp|Q41803|EF1A_MAIZE Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 148 561 3.0E-82
sp|P29521|EF1A1_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 148 561 4.0E-82
sp|O29325|EF1A_ARCFU Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 151 560 5.0E-82
sp|Q8R050|ERF3A_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=2 151 558 1.0E-81
sp|O49169|EF1A_MANES Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 148 561 1.0E-81
sp|P25166|EF1A_STYLE Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1 151 561 2.0E-81
sp|P27592|EF1A_ONCVO Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1 148 561 2.0E-81
sp|Q2HJN8|EF1A2_OSCTI Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 148 561 2.0E-81
sp|A6UV43|EF1A_META3 Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 159 560 4.0E-81
sp|Q2HJN6|EF1A3_OSCTI Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 151 561 4.0E-81
sp|Q12WT3|EF1A_METBU Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 151 560 5.0E-81
sp|Q8PUR8|EF1A_METMA Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 151 560 6.0E-81
sp|Q40034|EF1A2_HORVU Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 148 561 7.0E-81
sp|Q2HJN9|EF1A4_OSCTI Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1 148 561 8.0E-81
sp|P29520|EF1A_BOMMO Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 148 561 1.0E-80
sp|P51554|EF1A_HYDVU Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 150 561 1.0E-80
sp|P25698|EF1A_SOYBN Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2 148 561 1.0E-80
sp|P19039|EF1A_APIME Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 148 561 2.0E-80
sp|P34824|EF1A1_HORVU Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 148 561 2.0E-80
sp|Q2HJN4|EF1A1_OSCTI Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 148 561 3.0E-80
sp|C6A4R7|EF1A_THESM Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 151 560 3.0E-80
sp|O24534|EF1A_VICFA Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 148 561 3.0E-80
sp|Q464Z4|EF1A_METBF Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 151 560 3.0E-80
sp|Q03033|EF1A_WHEAT Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 148 561 7.0E-80
sp|Q976B1|EF1A_SULTO Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 151 560 7.0E-80
sp|P08736|EF1A1_DROME Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 148 561 1.0E-79
sp|P13549|EF1A0_XENLA Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 148 561 4.0E-79
sp|P02993|EF1A_ARTSA Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 148 561 5.0E-79
sp|P23637|ERF3_OGAPI Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 86 558 5.0E-79
sp|Q41011|EF1A_PEA Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1 148 561 7.0E-79
sp|P62632|EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 148 561 7.0E-79
sp|P62631|EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 148 561 7.0E-79
sp|Q71V39|EF1A2_RABIT Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 148 561 8.0E-79
sp|Q05639|EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 148 561 8.0E-79
sp|Q32PH8|EF1A2_BOVIN Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 148 561 8.0E-79
sp|Q9YIC0|EF1A_ORYLA Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 148 561 1.0E-78
sp|A6UQ14|EF1A_METVS Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 159 559 3.0E-78
sp|A2Q0Z0|EF1A1_HORSE Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 148 561 4.0E-78
sp|P07810|EF1A_METVA Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 159 559 1.0E-77
sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 148 561 3.0E-77
sp|A0B7D6|EF1A_METTP Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 151 561 3.0E-77
sp|P68105|EF1A1_RABIT Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 148 561 3.0E-77
sp|Q5R4R8|EF1A1_PONAB Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 148 561 3.0E-77
sp|Q5R1X2|EF1A1_PANTR Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 148 561 3.0E-77
sp|P68104|EF1A1_HUMAN Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 148 561 3.0E-77
sp|Q66RN5|EF1A1_FELCA Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 148 561 3.0E-77
sp|P68103|EF1A1_BOVIN Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 148 561 3.0E-77
sp|Q0W8G2|EF1A_METAR Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 151 560 3.0E-77
sp|Q8U152|EF1A_PYRFU Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 151 560 3.0E-77
sp|P62630|EF1A1_RAT Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 148 561 3.0E-77
sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 148 561 3.0E-77
sp|P62629|EF1A1_CRIGR Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 148 561 3.0E-77
sp|A6VGV6|EF1A_METM7 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 159 559 3.0E-77
sp|A9A9U3|EF1A_METM6 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 159 559 4.0E-77
sp|P26751|EF1A_PYRWO Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 151 560 4.0E-77
sp|Q90835|EF1A_CHICK Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 148 561 5.0E-77
sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 161 542 6.0E-77
sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 151 558 6.0E-77
sp|A4FWE9|EF1A_METM5 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 159 559 8.0E-77
sp|P17507|EF1A2_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 148 561 2.0E-76
sp|B6YVG2|EF1A_THEON Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 151 560 4.0E-76
sp|P17508|EF1A3_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 148 561 4.0E-76
sp|P05303|EF1A2_DROME Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 148 561 5.0E-76
sp|Q27140|EF1A2_EUPCR Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1 151 561 5.0E-76
sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 151 558 7.0E-76
sp|Q6LXI1|EF1A_METMP Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 159 559 8.0E-76
sp|Q92005|EF1A_DANRE Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 148 561 9.0E-76
sp|P84316|EF1A_HELZE Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 161 542 1.0E-75
sp|P84315|EF1A_HELVI Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 161 542 1.0E-75
sp|P84318|EF1A_HELGL Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 161 542 1.0E-75
sp|P84320|EF1A_HELDI Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 161 542 1.0E-75
sp|P84317|EF1A_HELAM Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 161 542 1.0E-75
sp|P84319|EF1A_HELAL Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 161 542 1.0E-75
sp|P84322|EF1A_ANIIF Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 161 542 1.0E-75
sp|P84321|EF1A_ADIBE Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 161 542 1.0E-75
sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 140 558 2.0E-75
sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 151 558 3.0E-75
sp|Q8TYP6|EF1A_METKA Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 151 560 3.0E-75
sp|P17197|EF1A_THECE Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 151 560 4.0E-75
sp|O59153|EF1A_PYRHO Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 151 560 2.0E-74
sp|Q2FRI3|EF1A_METHJ Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 149 560 2.0E-74
sp|A3CTG3|EF1A_METMJ Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 151 560 3.0E-74
sp|Q5JFZ4|EF1A_THEKO Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 151 560 4.0E-74
sp|Q9V0V7|EF1A_PYRAB Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 151 560 8.0E-74
sp|C5A5P4|EF1A_THEGJ Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 151 560 9.0E-74
sp|A5ULM5|EF1A_METS3 Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 151 560 2.0E-73
sp|Q9HGI6|ERF3_DEBHA Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 84 558 2.0E-72
sp|P05453|ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP35 PE=1 SV=1 151 558 3.0E-72
sp|P17506|EF1A1_XENLA Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2 151 533 6.0E-72
sp|Q74MI6|EF1A_NANEQ Elongation factor 1-alpha OS=Nanoarchaeum equitans (strain Kin4-M) GN=tuf PE=3 SV=1 151 559 1.0E-71
sp|O74718|ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 151 558 2.0E-70
sp|Q08046|EF1A_GIAIN Elongation factor 1-alpha (Fragment) OS=Giardia intestinalis GN=TEF1 PE=2 SV=1 167 539 1.0E-69
sp|Q7YZN9|ERF3_DICDI Eukaryotic peptide chain release factor GTP-binding subunit OS=Dictyostelium discoideum GN=erf3 PE=2 SV=1 151 558 2.0E-67
sp|O27132|EF1A_METTH Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 151 560 3.0E-67
sp|Q2NEL1|EF1A_METST Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 151 560 2.0E-66
sp|P50257|EF1AS_PORPU Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1 148 481 1.0E-64
sp|A8EWR6|CYSN_ARCB4 Sulfate adenylyltransferase subunit 1 OS=Arcobacter butzleri (strain RM4018) GN=cysN PE=3 SV=1 142 460 3.0E-62
sp|B3PII1|CYSN_CELJU Sulfate adenylyltransferase subunit 1 OS=Cellvibrio japonicus (strain Ueda107) GN=cysN PE=3 SV=1 151 466 3.0E-61
sp|P27634|EF1A_RHYAM Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1 199 561 6.0E-59
sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 140 560 1.0E-58
sp|Q21IS6|CYSN_SACD2 Sulfate adenylyltransferase subunit 1 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysN PE=3 SV=1 151 560 6.0E-58
sp|Q7NVN5|CYSN_CHRVO Sulfate adenylyltransferase subunit 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysN PE=3 SV=1 139 462 2.0E-56
sp|Q8AAP9|CYSN_BACTN Sulfate adenylyltransferase subunit 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysN PE=3 SV=1 139 460 3.0E-55
sp|Q482Z9|CYSN_COLP3 Sulfate adenylyltransferase subunit 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysN PE=3 SV=1 142 530 6.0E-55
sp|A4IXZ5|CYSN_FRATW Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cysN PE=3 SV=1 140 459 8.0E-55
sp|Q64VQ9|CYSN_BACFR Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain YCH46) GN=cysN PE=3 SV=1 139 460 2.0E-54
sp|Q5LES3|CYSN_BACFN Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysN PE=3 SV=1 139 460 2.0E-54
sp|B1KMH4|CYSN_SHEWM Sulfate adenylyltransferase subunit 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysN PE=3 SV=1 157 464 3.0E-54
sp|Q7UMW2|CYSNC_RHOBA Bifunctional enzyme CysN/CysC OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysNC PE=3 SV=1 151 560 4.0E-54
sp|Q5NG10|CYSN_FRATT Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cysN PE=3 SV=1 140 459 6.0E-54
sp|Q14HG2|CYSN_FRAT1 Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cysN PE=3 SV=1 140 459 6.0E-54
sp|A0KP35|CYSN_AERHH Sulfate adenylyltransferase subunit 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysN PE=3 SV=1 151 503 1.0E-53
sp|Q1QUF9|CYSN_CHRSD Sulfate adenylyltransferase subunit 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysN PE=3 SV=1 151 560 2.0E-53
sp|B2TZI0|CYSN_SHIB3 Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysN PE=3 SV=1 151 466 4.0E-53
sp|B7LWK4|CYSN_ESCF3 Sulfate adenylyltransferase subunit 1 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysN PE=3 SV=1 151 462 4.0E-53
sp|C4LAG3|CYSN_TOLAT Sulfate adenylyltransferase subunit 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysN PE=3 SV=1 145 460 4.0E-53
sp|C5BSJ5|CYSN_TERTT Sulfate adenylyltransferase subunit 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysN PE=3 SV=1 151 559 5.0E-53
sp|B7UHH0|CYSN_ECO27 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysN PE=3 SV=1 151 462 1.0E-52
sp|B1Z7C0|CYSN_METPB Sulfate adenylyltransferase subunit 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=cysN PE=3 SV=1 134 475 1.0E-52
sp|Q15VB8|CYSN_PSEA6 Sulfate adenylyltransferase subunit 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cysN PE=3 SV=1 140 560 1.0E-52
sp|Q31XB3|CYSN_SHIBS Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|B2VG01|CYSN_ERWT9 Sulfate adenylyltransferase subunit 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysN PE=3 SV=1 151 462 2.0E-52
sp|Q8DE73|CYSN_VIBVU Sulfate adenylyltransferase subunit 1 OS=Vibrio vulnificus (strain CMCP6) GN=cysN PE=3 SV=1 151 459 2.0E-52
sp|A9W4X1|CYSN_METEP Sulfate adenylyltransferase subunit 1 OS=Methylobacterium extorquens (strain PA1) GN=cysN PE=3 SV=1 134 475 2.0E-52
sp|Q1R7U0|CYSN_ECOUT Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|Q8FEJ1|CYSN_ECOL6 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|A1AEU5|CYSN_ECOK1 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O1:K1 / APEC GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|B7MKM5|CYSN_ECO45 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 151 480 2.0E-52
sp|Q3YYB1|CYSN_SHISS Sulfate adenylyltransferase subunit 1 OS=Shigella sonnei (strain Ss046) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|B1LQ72|CYSN_ECOSM Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|P23845|CYSN_ECOLI Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12) GN=cysN PE=1 SV=1 151 466 2.0E-52
sp|Q0TEA7|CYSN_ECOL5 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|B1XCS7|CYSN_ECODH Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / DH10B) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|C4ZZQ5|CYSN_ECOBW Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|B7MZ52|CYSN_ECO81 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O81 (strain ED1a) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|B7NT95|CYSN_ECO7I Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|A8A3N0|CYSN_ECOHS Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O9:H4 (strain HS) GN=cysN PE=3 SV=1 151 466 2.0E-52
sp|A0Q6F0|CYSN_FRATN Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. novicida (strain U112) GN=cysN PE=3 SV=1 140 459 2.0E-52
sp|B5Z3B3|CYSN_ECO5E Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysN PE=3 SV=1 151 466 3.0E-52
sp|Q8X7X7|CYSN_ECO57 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 GN=cysN PE=3 SV=1 151 466 3.0E-52
sp|B1IUS8|CYSN_ECOLC Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysN PE=3 SV=1 151 466 3.0E-52
sp|A6QB12|CYSN_SULNB Sulfate adenylyltransferase subunit 1 OS=Sulfurovum sp. (strain NBC37-1) GN=cysN PE=3 SV=1 142 560 3.0E-52
sp|B5FGJ9|CYSN_VIBFM Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain MJ11) GN=cysN PE=3 SV=1 151 561 3.0E-52
sp|B6ELP3|CYSN_ALISL Sulfate adenylyltransferase subunit 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=cysN PE=3 SV=1 151 472 4.0E-52
sp|A7ZQJ5|CYSN_ECO24 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysN PE=3 SV=1 151 466 4.0E-52
sp|B6I6E1|CYSN_ECOSE Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SE11) GN=cysN PE=3 SV=1 151 466 5.0E-52
sp|P72339|NODQ_RHIS3 Bifunctional enzyme NodQ OS=Rhizobium sp. (strain N33) GN=nodQ PE=3 SV=1 140 486 5.0E-52
sp|A7MWE9|CYSN_VIBCB Sulfate adenylyltransferase subunit 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cysN PE=3 SV=1 151 459 6.0E-52
sp|Q5E830|CYSN_VIBF1 Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysN PE=3 SV=1 151 561 6.0E-52
sp|B7LXG3|CYSN_ECO8A Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O8 (strain IAI1) GN=cysN PE=3 SV=1 151 466 6.0E-52
sp|B7LEG9|CYSN_ECO55 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain 55989 / EAEC) GN=cysN PE=3 SV=1 151 466 6.0E-52
sp|Q32CH9|CYSN_SHIDS Sulfate adenylyltransferase subunit 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysN PE=3 SV=1 151 466 6.0E-52
sp|B7L0X9|CYSN_METC4 Sulfate adenylyltransferase subunit 1 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=cysN PE=3 SV=1 134 475 6.0E-52
sp|A8ANW5|CYSN_CITK8 Sulfate adenylyltransferase subunit 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysN PE=3 SV=1 151 462 1.0E-51
sp|B5RDQ7|CYSN_SALG2 Sulfate adenylyltransferase subunit 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysN PE=3 SV=1 151 466 1.0E-51
sp|B5QW22|CYSN_SALEP Sulfate adenylyltransferase subunit 1 OS=Salmonella enteritidis PT4 (strain P125109) GN=cysN PE=3 SV=1 151 466 2.0E-51
sp|Q7MPF2|CYSN_VIBVY Sulfate adenylyltransferase subunit 1 OS=Vibrio vulnificus (strain YJ016) GN=cysN PE=3 SV=1 151 459 2.0E-51
sp|C1D890|CYSN_LARHH Sulfate adenylyltransferase subunit 1 OS=Laribacter hongkongensis (strain HLHK9) GN=cysN PE=3 SV=1 151 485 2.0E-51
sp|A7MJ69|CYSN_CROS8 Sulfate adenylyltransferase subunit 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysN PE=3 SV=1 151 462 2.0E-51
sp|B7N6Y1|CYSN_ECOLU Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysN PE=3 SV=1 151 466 3.0E-51
sp|B5FTS9|CYSN_SALDC Sulfate adenylyltransferase subunit 1 OS=Salmonella dublin (strain CT_02021853) GN=cysN PE=3 SV=1 151 466 3.0E-51
sp|B4TTW5|CYSN_SALSV Sulfate adenylyltransferase subunit 1 OS=Salmonella schwarzengrund (strain CVM19633) GN=cysN PE=3 SV=1 151 466 3.0E-51
sp|B5F415|CYSN_SALA4 Sulfate adenylyltransferase subunit 1 OS=Salmonella agona (strain SL483) GN=cysN PE=3 SV=1 151 466 3.0E-51
sp|A4SRG8|CYSN_AERS4 Sulfate adenylyltransferase subunit 1 OS=Aeromonas salmonicida (strain A449) GN=cysN PE=3 SV=1 151 462 3.0E-51
sp|Q8ZMF5|CYSN_SALTY Sulfate adenylyltransferase subunit 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysN PE=3 SV=1 151 466 4.0E-51
sp|B4TFX1|CYSN_SALHS Sulfate adenylyltransferase subunit 1 OS=Salmonella heidelberg (strain SL476) GN=cysN PE=3 SV=1 151 466 4.0E-51
sp|A9N2D8|CYSN_SALPB Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysN PE=3 SV=1 151 466 4.0E-51
sp|B5BEY8|CYSN_SALPK Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain AKU_12601) GN=cysN PE=3 SV=1 151 466 8.0E-51
sp|Q5PEH2|CYSN_SALPA Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysN PE=3 SV=1 151 466 8.0E-51
sp|P52978|NODQ_RHITR Bifunctional enzyme NodQ OS=Rhizobium tropici GN=nodQ PE=3 SV=1 156 561 1.0E-50
sp|B4T461|CYSN_SALNS Sulfate adenylyltransferase subunit 1 OS=Salmonella newport (strain SL254) GN=cysN PE=3 SV=1 151 466 2.0E-50
sp|Q8Z470|CYSN_SALTI Sulfate adenylyltransferase subunit 1 OS=Salmonella typhi GN=cysN PE=3 SV=1 151 466 2.0E-50
sp|Q0T1I2|CYSN_SHIF8 Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=cysN PE=3 SV=1 151 466 2.0E-50
sp|Q83JX8|CYSN_SHIFL Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri GN=cysN PE=3 SV=1 151 466 2.0E-50
sp|B4RTW4|CYSN_ALTMD Sulfate adenylyltransferase subunit 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=cysN PE=3 SV=1 140 513 3.0E-50
sp|P56893|CYSN_RHIME Sulfate adenylyltransferase subunit 1 OS=Rhizobium meliloti (strain 1021) GN=cysN PE=3 SV=1 156 479 3.0E-50
sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 142 561 3.0E-50
sp|Q9PD78|CYSNC_XYLFA Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain 9a5c) GN=cysNC PE=3 SV=2 141 486 3.0E-50
sp|C0PXB1|CYSN_SALPC Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi C (strain RKS4594) GN=cysN PE=3 SV=1 151 466 5.0E-50
sp|Q57KJ0|CYSN_SALCH Sulfate adenylyltransferase subunit 1 OS=Salmonella choleraesuis (strain SC-B67) GN=cysN PE=3 SV=1 151 466 5.0E-50
sp|A5F578|CYSN_VIBC3 Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysN PE=3 SV=1 151 459 5.0E-50
sp|Q8UH69|CYSN_AGRFC Sulfate adenylyltransferase subunit 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysN PE=3 SV=1 156 460 5.0E-50
sp|B7VKY2|CYSN_VIBTL Sulfate adenylyltransferase subunit 1 OS=Vibrio tasmaniensis (strain LGP32) GN=cysN PE=3 SV=1 151 460 6.0E-50
sp|A1JJT0|CYSN_YERE8 Sulfate adenylyltransferase subunit 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysN PE=3 SV=1 151 469 6.0E-50
sp|C3LRM1|CYSN_VIBCM Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysN PE=3 SV=1 151 459 7.0E-50
sp|Q9KP20|CYSN_VIBCH Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysN PE=3 SV=1 151 459 7.0E-50
sp|Q87SX9|CYSN_VIBPA Sulfate adenylyltransferase subunit 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysN PE=3 SV=1 151 459 1.0E-49
sp|Q7N8L0|CYSN_PHOLL Sulfate adenylyltransferase subunit 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysN PE=3 SV=1 156 466 2.0E-49
sp|Q87DG7|CYSNC_XYLFT Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysNC PE=3 SV=1 141 486 2.0E-49
sp|A9MF24|CYSN_SALAR Sulfate adenylyltransferase subunit 1 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysN PE=3 SV=1 151 457 2.0E-49
sp|A1ST27|CYSN_PSYIN Sulfate adenylyltransferase subunit 1 OS=Psychromonas ingrahamii (strain 37) GN=cysN PE=3 SV=1 156 459 5.0E-49
sp|O33581|CYSN_RHITR Sulfate adenylyltransferase subunit 1 OS=Rhizobium tropici GN=cysN PE=3 SV=2 156 479 6.0E-49
sp|Q8EB10|CYSN_SHEON Sulfate adenylyltransferase subunit 1 OS=Shewanella oneidensis (strain MR-1) GN=cysN PE=3 SV=2 156 460 1.0E-48
sp|B9JB95|CYSN_AGRRK Sulfate adenylyltransferase subunit 1 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=cysN PE=3 SV=1 156 479 3.0E-48
sp|Q66EC7|CYSN_YERPS Sulfate adenylyltransferase subunit 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysN PE=3 SV=1 151 469 3.0E-48
sp|Q8ZBP2|CYSN_YERPE Sulfate adenylyltransferase subunit 1 OS=Yersinia pestis GN=cysN PE=3 SV=1 151 469 3.0E-48
sp|A7FLY2|CYSN_YERP3 Sulfate adenylyltransferase subunit 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysN PE=3 SV=1 151 469 3.0E-48
sp|Q8SS29|EF1A_ENCCU Elongation factor 1-alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TEF1 PE=1 SV=2 159 525 9.0E-47
sp|P9WNM5|CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 160 460 1.0E-46
sp|P9WNM4|CYSNC_MYCTO Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 160 460 1.0E-46
sp|Q2NVM8|CYSN_SODGM Sulfate adenylyltransferase subunit 1 OS=Sodalis glossinidius (strain morsitans) GN=cysN PE=3 SV=1 151 473 2.0E-45
sp|A5D5I8|EFTU2_PELTS Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 159 560 7.0E-45
sp|A5D5K0|EFTU1_PELTS Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 151 560 1.0E-44
sp|Q6LM69|CYSN_PHOPR Sulfate adenylyltransferase subunit 1 OS=Photobacterium profundum GN=cysN PE=3 SV=1 151 466 8.0E-44
sp|P28604|NODQ_AZOBR Bifunctional enzyme NodQ OS=Azospirillum brasilense GN=nodQ PE=3 SV=2 145 445 1.0E-43
sp|Q07051|EF1A_EIMBO Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1 251 561 3.0E-43
sp|B0TC54|EFTU_HELMI Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 159 560 1.0E-42
sp|B9MQH1|EFTU_CALBD Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 159 558 3.0E-42
sp|A4XI37|EFTU_CALS8 Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 159 558 6.0E-42
sp|B7IHU4|EFTU_THEAB Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 159 560 7.0E-42
sp|P57498|CYSN_BUCAI Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysN PE=3 SV=1 156 461 1.0E-41
sp|B8D7V3|CYSN_BUCAT Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=cysN PE=3 SV=1 156 461 1.0E-41
sp|B8D9K1|CYSN_BUCA5 Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cysN PE=3 SV=1 156 461 1.0E-41
sp|A5N4N1|EFTU_CLOK5 Elongation factor Tu OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tuf1 PE=3 SV=1 159 560 4.0E-41
sp|P13537|EFTU_THEMA Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 159 560 6.0E-41
sp|B1LBP2|EFTU_THESQ Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 159 560 1.0E-40
sp|A5IM81|EFTU_THEP1 Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 159 560 1.0E-40
sp|Q2RFP5|EFTU_MOOTA Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 159 560 1.0E-40
sp|Q04B37|EFTU_LACDB Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 151 558 2.0E-40
sp|Q1GAQ0|EFTU_LACDA Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 151 558 2.0E-40
sp|P33165|EFTU_BACFR Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 151 558 4.0E-40
sp|Q5L890|EFTU_BACFN Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 151 558 4.0E-40
sp|A9BHA7|EFTU_PETMO Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 159 560 5.0E-40
sp|A8F4Q9|EFTU_PSELT Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 159 560 8.0E-40
sp|A6LLL1|EFTU_THEM4 Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 159 560 9.0E-40
sp|B9K884|EFTU_THENN Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 159 560 2.0E-39
sp|Q74JU6|EFTU_LACJO Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tuf PE=3 SV=1 151 558 4.0E-39
sp|Q250N4|EFTU_DESHY Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 159 560 7.0E-39
sp|B8G1W4|EFTU_DESHD Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 159 560 7.0E-39
sp|Q042T5|EFTU_LACGA Elongation factor Tu OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tuf PE=3 SV=2 151 558 1.0E-38
sp|A5DN78|EFTU_PICGU Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 159 560 1.0E-38
sp|A9WFP3|EFTU_CHLAA Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1 159 560 2.0E-38
sp|Q0AUG3|EFTU2_SYNWW Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 159 560 2.0E-38
sp|A4J0Z5|EFTU_DESRM Elongation factor Tu OS=Desulfotomaculum reducens (strain MI-1) GN=tuf PE=3 SV=1 151 560 3.0E-38
sp|A6LPP6|EFTU_CLOB8 Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 151 560 3.0E-38
sp|O50340|EFTU_FERIS Elongation factor Tu OS=Fervidobacterium islandicum GN=tuf PE=3 SV=1 159 560 4.0E-38
sp|Q05FI3|EFTU_CARRP Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1 159 560 4.0E-38
sp|A7HM54|EFTU_FERNB Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 159 560 6.0E-38
sp|Q0AUH8|EFTU1_SYNWW Elongation factor Tu 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf1 PE=3 SV=1 159 560 6.0E-38
sp|Q8A463|EFTU_BACTN Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 151 558 6.0E-38
sp|Q3A9R3|EFTU1_CARHZ Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 150 560 7.0E-38
sp|A5GW14|EFTU_SYNR3 Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 151 560 7.0E-38
sp|B6YQ04|EFTU_AZOPC Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 151 558 7.0E-38
sp|B2RL52|EFTU_PORG3 Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 159 558 9.0E-38
sp|B2GIL2|EFTU_KOCRD Elongation factor Tu OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=tuf PE=3 SV=1 159 558 1.0E-37
sp|A6KYK9|EFTU_BACV8 Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 151 558 1.0E-37
sp|Q47LJ1|EFTU_THEFY Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 159 558 2.0E-37
sp|A8YUS2|EFTU_LACH4 Elongation factor Tu OS=Lactobacillus helveticus (strain DPC 4571) GN=tuf PE=3 SV=1 151 558 2.0E-37
sp|Q5YPG4|EFTU_NOCFA Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 159 558 2.0E-37
sp|Q3A9P8|EFTU2_CARHZ Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 150 560 2.0E-37
sp|Q46IW4|EFTU_PROMT Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 159 560 3.0E-37
sp|A3DJ00|EFTU_CLOTH Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 159 558 4.0E-37
sp|Q2S1P8|EFTU_SALRD Elongation factor Tu OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tuf1 PE=3 SV=1 159 560 4.0E-37
sp|Q01SX2|EFTU_SOLUE Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 159 558 4.0E-37
sp|A2C4U5|EFTU_PROM1 Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 159 560 5.0E-37
sp|A6LE88|EFTU_PARD8 Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 151 558 5.0E-37
sp|A6Q1L5|EFTU_NITSB Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 151 560 5.0E-37
sp|Q8KTA1|EFTU_RICMO Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 159 560 6.0E-37
sp|O21245|EFTU_RECAM Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 151 560 6.0E-37
sp|Q5GWR8|EFTU_XANOR Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 159 560 6.0E-37
sp|Q2NZX1|EFTU_XANOM Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 159 560 6.0E-37
sp|A7HBL7|EFTU_ANADF Elongation factor Tu OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tuf1 PE=3 SV=1 159 560 6.0E-37
sp|Q2JUX4|EFTU_SYNJA Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 159 560 7.0E-37
sp|Q8KTA6|EFTU_RICPA Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 159 560 7.0E-37
sp|Q255F3|EFTU_CHLFF Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 159 560 7.0E-37
sp|P02992|EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 159 560 8.0E-37
sp|P42480|EFTU_HYMOC Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 151 558 8.0E-37
sp|P42472|EFTU_CHLAU Elongation factor Tu (Fragment) OS=Chloroflexus aurantiacus GN=tuf PE=3 SV=1 161 560 8.0E-37
sp|Q8EX18|EFTU_MYCPE Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 151 558 9.0E-37
sp|A5GIP0|EFTU_SYNPW Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 151 560 9.0E-37
sp|Q5FKR8|EFTU_LACAC Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tuf PE=3 SV=1 151 558 9.0E-37
sp|A8F2E9|EFTU_RICM5 Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 159 560 1.0E-36
sp|P40175|EFTU3_STRCO Elongation factor Tu-3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf3 PE=3 SV=2 159 558 1.0E-36
sp|Q6MU81|EFTU_MYCMS Elongation factor Tu OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=tuf PE=3 SV=1 159 558 2.0E-36
sp|Q2SSW8|EFTU_MYCCT Elongation factor Tu OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=tuf PE=3 SV=1 159 558 2.0E-36
sp|Q11Q98|EFTU_CYTH3 Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 159 558 2.0E-36
sp|A1SNN5|EFTU_NOCSJ Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 151 558 2.0E-36
sp|Q9Z9A7|EFTU_CHLPN Elongation factor Tu OS=Chlamydia pneumoniae GN=tuf PE=3 SV=3 159 560 2.0E-36
sp|Q826Z7|EFTU2_STRAW Elongation factor Tu 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf2 PE=3 SV=1 159 558 2.0E-36
sp|Q3AMT6|EFTU_SYNSC Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 159 560 2.0E-36
sp|P29544|EFTU3_STRRA Elongation factor Tu-3 OS=Streptomyces ramocissimus GN=tuf3 PE=3 SV=1 159 558 2.0E-36
sp|A5USJ1|EFTU1_ROSS1 Elongation factor Tu 1 OS=Roseiflexus sp. (strain RS-1) GN=tuf1 PE=3 SV=1 159 560 2.0E-36
sp|Q877P8|EFTU_XYLFT Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 159 560 2.0E-36
sp|Q877L9|EFTU_CLOTE Elongation factor Tu OS=Clostridium tetani (strain Massachusetts / E88) GN=tufA PE=3 SV=1 196 560 2.0E-36
sp|B5ZC31|EFTU_UREU1 Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 159 558 3.0E-36
sp|Q822I4|EFTU_CHLCV Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 159 560 3.0E-36
sp|Q5L5H6|EFTU_CHLAB Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 159 560 3.0E-36
sp|Q9P9Q9|EFTU_XYLFA Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 159 560 3.0E-36
sp|A2CC87|EFTU_PROM3 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 151 560 3.0E-36
sp|Q92GW4|EFTU_RICCN Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 159 560 4.0E-36
sp|A8GT71|EFTU_RICRS Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 159 560 4.0E-36
sp|B0BUR2|EFTU_RICRO Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 159 560 4.0E-36
sp|C4K2I2|EFTU_RICPU Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 159 560 4.0E-36
sp|C3PPA9|EFTU_RICAE Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 159 560 4.0E-36
sp|Q7V500|EFTU_PROMM Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 151 560 4.0E-36
sp|A2BYN4|EFTU_PROM5 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 151 560 5.0E-36
sp|Q1D776|EFTU2_MYXXD Elongation factor Tu 2 OS=Myxococcus xanthus (strain DK 1622) GN=tuf2 PE=3 SV=1 159 560 5.0E-36
sp|B8HD11|EFTU_ARTCA Elongation factor Tu OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=tuf PE=3 SV=1 151 558 5.0E-36
sp|Q1H4N9|EFTU2_METFK Elongation factor Tu 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf2 PE=3 SV=1 159 560 5.0E-36
sp|Q1RHL9|EFTU_RICBR Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 159 560 5.0E-36
sp|A8GVB2|EFTU_RICB8 Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 159 560 5.0E-36
sp|Q1D7V1|EFTU1_MYXXD Elongation factor Tu 1 OS=Myxococcus xanthus (strain DK 1622) GN=tuf1 PE=3 SV=1 159 560 6.0E-36
sp|A7NR65|EFTU1_ROSCS Elongation factor Tu 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tuf1 PE=3 SV=1 159 560 6.0E-36
sp|Q04FQ4|EFTU_OENOB Elongation factor Tu OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=tuf PE=3 SV=1 151 558 8.0E-36
sp|A9KRZ4|EFTU_CLOPH Elongation factor Tu OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=tuf PE=3 SV=1 151 558 8.0E-36
sp|A0LRL8|EFTU_ACIC1 Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 151 558 9.0E-36
sp|Q3BWY6|EFTU_XANC5 Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 159 560 9.0E-36
sp|Q8NL22|EFTU_XANAC Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 159 560 9.0E-36
sp|B3WE38|EFTU_LACCB Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 151 560 1.0E-35
sp|Q039K9|EFTU_LACC3 Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 151 560 1.0E-35
sp|A7ZCN0|EFTU_CAMC1 Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 159 560 1.0E-35
sp|Q0BUQ2|EFTU_GRABC Elongation factor Tu OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=tuf PE=3 SV=1 151 560 1.0E-35
sp|A8EZL8|EFTU_RICCK Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 159 560 1.0E-35
sp|P0A3B0|EFTU_RICSI Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 159 560 1.0E-35
sp|P0A3A9|EFTU_RICRI Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 159 560 1.0E-35
sp|A5CCA0|EFTU1_ORITB Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 151 558 1.0E-35
sp|Q5NQ65|EFTU_ZYMMO Elongation factor Tu OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tuf PE=3 SV=1 151 560 1.0E-35
sp|P42481|EFTU_THIDL Elongation factor Tu OS=Thiomonas delicata GN=tuf PE=3 SV=1 159 560 1.0E-35
sp|Q1H4Q1|EFTU1_METFK Elongation factor Tu 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf1 PE=3 SV=1 159 560 2.0E-35
sp|Q7U4D1|EFTU_SYNPX Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 151 560 2.0E-35
sp|A8Z5T8|EFTU_SULMW Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 159 558 2.0E-35
sp|P48865|EFTU_RICPR Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 159 560 2.0E-35
sp|P50371|EFTU_CHACO Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 159 560 2.0E-35
sp|C4Z2R9|EFTU_EUBE2 Elongation factor Tu OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=tuf PE=3 SV=1 151 558 2.0E-35
sp|A0JZ88|EFTU_ARTS2 Elongation factor Tu OS=Arthrobacter sp. (strain FB24) GN=tuf PE=3 SV=1 151 558 2.0E-35
sp|A5UYI1|EFTU2_ROSS1 Elongation factor Tu 2 OS=Roseiflexus sp. (strain RS-1) GN=tuf2 PE=3 SV=1 159 560 2.0E-35
sp|B3ETZ7|EFTU_AMOA5 Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 151 558 2.0E-35
sp|C4LL63|EFTU_CORK4 Elongation factor Tu OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=tuf PE=3 SV=1 151 558 2.0E-35
sp|A8G708|EFTU_PROM2 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 159 560 3.0E-35
sp|A3PEZ7|EFTU_PROM0 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 159 560 3.0E-35
sp|Q9PK73|EFTU_CHLMU Elongation factor Tu OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tuf PE=3 SV=3 159 560 3.0E-35
sp|A2BT83|EFTU_PROMS Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 159 560 3.0E-35
sp|P50068|EFTU_UREPA Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tuf PE=3 SV=1 159 558 3.0E-35
sp|B1AJG3|EFTU_UREP2 Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tuf PE=3 SV=1 159 558 3.0E-35
sp|Q1ACI3|EFTU_CHAVU Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 159 560 3.0E-35
sp|Q6AP73|EFTU2_DESPS Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 159 560 3.0E-35
sp|A0QS98|EFTU_MYCS2 Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 159 558 3.0E-35
sp|Q9TJQ8|EFTU_PROWI Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 159 560 3.0E-35
sp|Q54HB2|EFTU_DICDI Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum GN=tufm PE=1 SV=2 143 560 3.0E-35
sp|Q7UZY7|EFTU_PROMP Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 159 560 3.0E-35
sp|C4ZB99|EFTU_EUBR3 Elongation factor Tu OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tuf PE=3 SV=1 151 558 4.0E-35
sp|A1T4L6|EFTU_MYCVP Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 159 558 4.0E-35
sp|Q6F0J5|EFTU_MESFL Elongation factor Tu OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=tuf PE=3 SV=1 159 558 4.0E-35
sp|A5CCL4|EFTU2_ORITB Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 151 558 4.0E-35
sp|B8I5N8|EFTU_CLOCE Elongation factor Tu OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=tuf PE=3 SV=1 159 558 5.0E-35
sp|B1KSM7|EFTU_CLOBM Elongation factor Tu OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tuf1 PE=3 SV=1 151 560 5.0E-35
sp|Q8KT95|EFTU_RICTY Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 159 560 5.0E-35
sp|Q318N5|EFTU_PROM9 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 159 560 5.0E-35
sp|Q1IHG6|EFTU_KORVE Elongation factor Tu OS=Koribacter versatilis (strain Ellin345) GN=tuf1 PE=3 SV=1 159 560 6.0E-35
sp|Q3J5S4|EFTU_RHOS4 Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tuf1 PE=3 SV=1 151 560 6.0E-35
sp|A3PGI1|EFTU_RHOS1 Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tuf1 PE=3 SV=1 151 560 6.0E-35
sp|Q0I0B9|EFTU1_SHESR Elongation factor Tu 1 OS=Shewanella sp. (strain MR-7) GN=tuf1 PE=3 SV=1 159 560 6.0E-35
sp|Q0HNV1|EFTU1_SHESM Elongation factor Tu 1 OS=Shewanella sp. (strain MR-4) GN=tuf1 PE=3 SV=1 159 560 6.0E-35
sp|A7GJ76|EFTU_CLOBL Elongation factor Tu OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tuf1 PE=3 SV=1 151 560 7.0E-35
sp|B1IGF6|EFTU_CLOBK Elongation factor Tu OS=Clostridium botulinum (strain Okra / Type B1) GN=tuf1 PE=3 SV=1 151 560 7.0E-35
sp|A5I7K8|EFTU_CLOBH Elongation factor Tu OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tuf1 PE=3 SV=1 151 560 7.0E-35
sp|A7FZ71|EFTU_CLOB1 Elongation factor Tu OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tuf1 PE=3 SV=1 151 560 7.0E-35
sp|Q72GW4|EFTU_THET2 Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 159 560 7.0E-35
sp|A7GZK6|EFTU_CAMC5 Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 159 560 8.0E-35
sp|Q8KT99|EFTU_RICHE Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 159 560 8.0E-35
sp|A1R8U9|EFTU_ARTAT Elongation factor Tu OS=Arthrobacter aurescens (strain TC1) GN=tuf PE=3 SV=1 151 558 8.0E-35
sp|A4WVL0|EFTU_RHOS5 Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tuf1 PE=3 SV=1 151 560 8.0E-35
sp|C5CGR6|EFTU_KOSOT Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1 159 560 8.0E-35
sp|C4K4F8|EFTU_HAMD5 Elongation factor Tu OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tuf PE=3 SV=1 159 560 9.0E-35
sp|Q83ES6|EFTU_COXBU Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 159 560 9.0E-35
sp|A9NAK7|EFTU_COXBR Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 159 560 9.0E-35
sp|A9KD33|EFTU_COXBN Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 159 560 9.0E-35
sp|Q8R7T8|EFTU2_CALS4 Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 159 560 9.0E-35
sp|P60339|EFTU2_THET8 Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 159 560 1.0E-34
sp|P60338|EFTU1_THETH Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 159 560 1.0E-34
sp|Q5SHN6|EFTU1_THET8 Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 159 560 1.0E-34
sp|P0CD71|EFTU_CHLTR Elongation factor Tu OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tuf PE=3 SV=1 159 560 1.0E-34
sp|Q3KM40|EFTU_CHLTA Elongation factor Tu OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tuf PE=3 SV=1 159 560 1.0E-34
sp|P33166|EFTU_BACSU Elongation factor Tu OS=Bacillus subtilis (strain 168) GN=tuf PE=3 SV=1 151 560 1.0E-34
sp|A8F982|EFTU_BACP2 Elongation factor Tu OS=Bacillus pumilus (strain SAFR-032) GN=tuf PE=3 SV=1 151 560 1.0E-34
sp|A5V604|EFTU_SPHWW Elongation factor Tu OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=tuf PE=3 SV=1 151 560 1.0E-34
sp|B0JSE0|EFTU_MICAN Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 159 560 2.0E-34
sp|B0BBV3|EFTU_CHLTB Elongation factor Tu OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tuf PE=3 SV=1 159 560 2.0E-34
sp|B0B7N8|EFTU_CHLT2 Elongation factor Tu OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tuf PE=1 SV=1 159 560 2.0E-34
sp|A1WVC4|EFTU1_HALHL Elongation factor Tu 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf1 PE=3 SV=1 159 560 2.0E-34
sp|A1WVD6|EFTU2_HALHL Elongation factor Tu 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf2 PE=3 SV=1 159 560 2.0E-34
sp|Q7VA05|EFTU_PROMA Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 151 560 2.0E-34
sp|Q8R7V2|EFTU1_CALS4 Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 159 560 2.0E-34
sp|Q4FLK5|EFTU_PELUB Elongation factor Tu OS=Pelagibacter ubique (strain HTCC1062) GN=tuf PE=3 SV=1 206 560 2.0E-34
sp|Q1BDD3|EFTU_MYCSS Elongation factor Tu OS=Mycobacterium sp. (strain MCS) GN=tuf PE=3 SV=1 151 558 2.0E-34
sp|A1UBL1|EFTU_MYCSK Elongation factor Tu OS=Mycobacterium sp. (strain KMS) GN=tuf PE=3 SV=1 151 558 2.0E-34
sp|A3PV96|EFTU_MYCSJ Elongation factor Tu OS=Mycobacterium sp. (strain JLS) GN=tuf PE=3 SV=1 151 558 2.0E-34
sp|P48864|EFTU_NEIGO Elongation factor Tu OS=Neisseria gonorrhoeae GN=tuf PE=3 SV=1 206 560 2.0E-34
sp|P95724|EFTU_STRCJ Elongation factor Tu OS=Streptomyces cinnamoneus GN=tuf PE=3 SV=2 151 558 2.0E-34
sp|Q2EEV7|EFTU_HELSJ Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 143 560 3.0E-34
sp|A4FPM7|EFTU_SACEN Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 151 558 3.0E-34
sp|C5C0J3|EFTU_BEUC1 Elongation factor Tu OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=tuf PE=3 SV=1 151 558 3.0E-34
sp|A9BCK0|EFTU_PROM4 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 159 560 3.0E-34
sp|A7NS01|EFTU2_ROSCS Elongation factor Tu 2 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tuf2 PE=3 SV=1 159 560 3.0E-34
sp|A5EX84|EFTU_DICNV Elongation factor Tu OS=Dichelobacter nodosus (strain VCS1703A) GN=tuf PE=3 SV=1 159 560 3.0E-34
sp|Q67JU1|EFTU_SYMTH Elongation factor Tu OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tuf PE=3 SV=1 159 558 4.0E-34
sp|O50293|EFTU_AQUPY Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 151 560 4.0E-34
sp|A8GPF2|EFTU_RICAH Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 159 560 4.0E-34
sp|Q8XGZ0|EFTU_RALSO Elongation factor Tu OS=Ralstonia solanacearum (strain GMI1000) GN=tufA PE=3 SV=1 159 560 4.0E-34
sp|A0RQJ3|EFTU_CAMFF Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 159 560 4.0E-34
sp|Q8PC51|EFTU2_XANCP Elongation factor Tu-B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufB PE=3 SV=1 159 560 4.0E-34
sp|Q4URD7|EFTU1_XANC8 Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf1 PE=3 SV=1 159 560 4.0E-34
sp|A0KRL0|EFTU_SHESA Elongation factor Tu OS=Shewanella sp. (strain ANA-3) GN=tuf1 PE=3 SV=1 159 560 4.0E-34
sp|Q8KTA3|EFTU_RICRH Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 151 560 5.0E-34
sp|Q2II78|EFTU_ANADE Elongation factor Tu OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tuf1 PE=3 SV=1 159 560 5.0E-34
sp|B0RU96|EFTU2_XANCB Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf2 PE=3 SV=1 159 560 5.0E-34
sp|Q4URC5|EFTU2_XANC8 Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf2 PE=3 SV=1 159 560 5.0E-34
sp|Q8PC59|EFTU1_XANCP Elongation factor Tu-A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufA PE=3 SV=1 159 560 5.0E-34
sp|Q01698|EFTU_THEAQ Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 159 560 5.0E-34
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10437
MSPADVYDEDDFVDQYDDYDDEDGELSPEDRKAMSEGTASVRRALGKDADKVTVTQIQEALWHYYYDIDKSVAYL
KKSFTSPAPKPTAKKTAEAGKKPATTPKAVKKTASNDAKKQAELTSSVSGLKINDAPPPKSKGLDVIKEFENGTV
KKSTSFVVVGHVDAGKSTLMGRLLLELKFVEQRTVEKYRRQAEKSGKQSFALAWVMDQGSEERDRGVTIDIATNH
FETPTTKFTILDAPGHRDFVPNMIAGASQADLAILVIDANTGAFERGLKGQTREHVLLLRSLGVQRLIVAVNKLD
TVDWSKERFDEISGQVNGFLTGLGFQSKHVSFVPISGLNGDNIARKIESPAASWYLGPTLMEALETTGPTATRAL
GKPFRMPISEVFRSQQGTTTLAGRIESGTVQIGDSVVVQPSGESAYIKSIVVDTDAQDWAVAGQSVSIALTNIDP
IHIRVGDIVCDARDPIKCGDTFTIKAMAFDHLMPMPVDLHRGRLHTPGQIQSIAAVLDKATGEVVKKKPKIVQPG
GVARMSIKLSSKVPLEAGHRVVIRSGGETIAAGLLE*
Coding >Hirsu2|10437
ATGTCTCCTGCAGACGTCTACGACGAGGACGACTTTGTCGATCAGTATGACGACTACGACGACGAGGATGGAGAG
CTCAGCCCGGAAGACAGGAAAGCAATGAGCGAGGGCACGGCCTCGGTCCGCAGAGCCCTGGGAAAGGACGCCGAC
AAGGTCACCGTCACTCAAATACAGGAGGCGCTGTGGCATTATTACTACGACATCGACAAGTCCGTTGCTTATCTG
AAGAAGTCCTTCACCTCACCTGCGCCGAAGCCAACGGCCAAGAAGACTGCAGAGGCGGGAAAGAAGCCTGCAACG
ACACCCAAGGCTGTGAAGAAAACGGCATCCAACGATGCCAAAAAGCAAGCGGAGCTCACGAGCTCCGTTTCTGGT
CTCAAAATCAACGACGCTCCCCCTCCAAAGAGCAAGGGCCTCGACGTTATTAAAGAATTCGAAAATGGCACCGTC
AAAAAGAGCACGAGCTTCGTCGTGGTGGGGCACGTGGACGCCGGCAAGAGTACGCTCATGGGTCGCCTCCTGTTG
GAACTAAAATTTGTCGAGCAGCGTACGGTGGAAAAGTATCGAAGGCAGGCCGAGAAGAGCGGCAAGCAGTCGTTC
GCCCTCGCTTGGGTTATGGACCAAGGAAGTGAGGAGCGGGACCGTGGTGTGACGATTGACATTGCGACAAACCAC
TTCGAGACTCCGACAACGAAATTTACGATCCTGGACGCACCGGGACATCGAGACTTTGTTCCGAACATGATCGCC
GGCGCCAGCCAGGCTGACCTTGCCATCCTGGTCATTGACGCGAATACGGGCGCTTTCGAGAGGGGTCTCAAGGGG
CAAACCCGAGAGCACGTTCTTCTCCTGCGAAGCTTAGGCGTTCAGCGCCTCATCGTGGCGGTGAACAAGCTTGAC
ACGGTGGATTGGTCCAAAGAACGCTTCGACGAAATCTCTGGGCAGGTCAACGGGTTTCTCACCGGCCTGGGGTTC
CAAAGCAAGCACGTGAGCTTCGTCCCAATCTCGGGTCTGAACGGGGACAATATCGCTCGTAAGATAGAGAGCCCA
GCGGCGAGCTGGTACCTGGGCCCCACCCTGATGGAAGCGCTGGAGACGACAGGGCCAACTGCCACACGAGCGCTA
GGGAAACCTTTCAGGATGCCGATTTCCGAGGTATTCAGGTCCCAGCAGGGGACGACCACGCTGGCTGGCCGAATC
GAGTCGGGAACGGTACAGATCGGCGACAGCGTTGTCGTGCAACCCAGCGGAGAGTCGGCTTACATCAAATCGATC
GTCGTGGACACGGACGCGCAGGACTGGGCGGTGGCGGGACAGAGCGTTAGCATCGCCCTGACGAACATCGACCCC
ATCCACATCAGGGTGGGCGACATCGTCTGTGACGCTAGAGACCCAATCAAGTGCGGCGACACCTTCACCATCAAG
GCCATGGCTTTCGACCACTTGATGCCGATGCCGGTGGATCTGCACCGCGGCCGCCTGCACACACCAGGTCAGATA
CAGTCTATTGCGGCAGTCCTCGACAAAGCGACCGGCGAGGTTGTCAAGAAGAAGCCCAAGATCGTCCAACCGGGC
GGGGTGGCCCGGATGTCGATCAAGCTGAGCTCCAAGGTTCCGTTGGAGGCCGGACACCGAGTGGTGATACGGAGC
GGAGGAGAGACAATCGCGGCAGGATTGCTGGAATAG
Transcript >Hirsu2|10437
ATGTCTCCTGCAGACGTCTACGACGAGGACGACTTTGTCGATCAGTATGACGACTACGACGACGAGGATGGAGAG
CTCAGCCCGGAAGACAGGAAAGCAATGAGCGAGGGCACGGCCTCGGTCCGCAGAGCCCTGGGAAAGGACGCCGAC
AAGGTCACCGTCACTCAAATACAGGAGGCGCTGTGGCATTATTACTACGACATCGACAAGTCCGTTGCTTATCTG
AAGAAGTCCTTCACCTCACCTGCGCCGAAGCCAACGGCCAAGAAGACTGCAGAGGCGGGAAAGAAGCCTGCAACG
ACACCCAAGGCTGTGAAGAAAACGGCATCCAACGATGCCAAAAAGCAAGCGGAGCTCACGAGCTCCGTTTCTGGT
CTCAAAATCAACGACGCTCCCCCTCCAAAGAGCAAGGGCCTCGACGTTATTAAAGAATTCGAAAATGGCACCGTC
AAAAAGAGCACGAGCTTCGTCGTGGTGGGGCACGTGGACGCCGGCAAGAGTACGCTCATGGGTCGCCTCCTGTTG
GAACTAAAATTTGTCGAGCAGCGTACGGTGGAAAAGTATCGAAGGCAGGCCGAGAAGAGCGGCAAGCAGTCGTTC
GCCCTCGCTTGGGTTATGGACCAAGGAAGTGAGGAGCGGGACCGTGGTGTGACGATTGACATTGCGACAAACCAC
TTCGAGACTCCGACAACGAAATTTACGATCCTGGACGCACCGGGACATCGAGACTTTGTTCCGAACATGATCGCC
GGCGCCAGCCAGGCTGACCTTGCCATCCTGGTCATTGACGCGAATACGGGCGCTTTCGAGAGGGGTCTCAAGGGG
CAAACCCGAGAGCACGTTCTTCTCCTGCGAAGCTTAGGCGTTCAGCGCCTCATCGTGGCGGTGAACAAGCTTGAC
ACGGTGGATTGGTCCAAAGAACGCTTCGACGAAATCTCTGGGCAGGTCAACGGGTTTCTCACCGGCCTGGGGTTC
CAAAGCAAGCACGTGAGCTTCGTCCCAATCTCGGGTCTGAACGGGGACAATATCGCTCGTAAGATAGAGAGCCCA
GCGGCGAGCTGGTACCTGGGCCCCACCCTGATGGAAGCGCTGGAGACGACAGGGCCAACTGCCACACGAGCGCTA
GGGAAACCTTTCAGGATGCCGATTTCCGAGGTATTCAGGTCCCAGCAGGGGACGACCACGCTGGCTGGCCGAATC
GAGTCGGGAACGGTACAGATCGGCGACAGCGTTGTCGTGCAACCCAGCGGAGAGTCGGCTTACATCAAATCGATC
GTCGTGGACACGGACGCGCAGGACTGGGCGGTGGCGGGACAGAGCGTTAGCATCGCCCTGACGAACATCGACCCC
ATCCACATCAGGGTGGGCGACATCGTCTGTGACGCTAGAGACCCAATCAAGTGCGGCGACACCTTCACCATCAAG
GCCATGGCTTTCGACCACTTGATGCCGATGCCGGTGGATCTGCACCGCGGCCGCCTGCACACACCAGGTCAGATA
CAGTCTATTGCGGCAGTCCTCGACAAAGCGACCGGCGAGGTTGTCAAGAAGAAGCCCAAGATCGTCCAACCGGGC
GGGGTGGCCCGGATGTCGATCAAGCTGAGCTCCAAGGTTCCGTTGGAGGCCGGACACCGAGTGGTGATACGGAGC
GGAGGAGAGACAATCGCGGCAGGATTGCTGGAATAG
Gene >Hirsu2|10437
ATGTCTCCTGCAGACGTCTACGACGAGGACGACTTTGTCGATCAGTATGACGACTACGACGACGAGGATGGAGAG
CTCAGCCCGGAAGACAGGAAAGCAATGAGCGAGGGCACGGCCTCGGTCCGCAGAGCCCTGGGAAAGGACGCCGAC
AAGGTCACCGTCACTCAAATACAGGAGGCGCTGTGGCATTATTACTACGACATCGACAAGTCCGTTGCTTATCTG
AAGAAGTCCTTCACCTCACCTGCGCCGAAGCCAACGGCCAAGAAGACTGCAGAGGGTAAGTCCGGTGAATTTTTT
TTCTCTGACCGACTCGGCCTGTTTGCGAGGACCCGTGGAGCAGAGCGGGCGCATCCGGTGTGCAACGCTCTAAAA
ATGGGCCATTGTCCCTGTGATCACGCCTTTGTCGCGCGGAACATTCACCCCTCTCGTGTCGGAGACGAGTTCAAT
GACATGCCCTGGTTGAGCGTACCGCAACATCGCCAAGCCGCACTTCTACCTCCCGTAGGCCCTCGAGGGGGTCTC
TTGGGAGGTGGCGAAGGCCCGGCCAAAATGTCTAAGCTCCAGGCTCTCGCCGCCGCCAGGAAGAAGAAGAATGAT
GAGAAAAAAGAGCACAACAAGGCCTCACAGGCAGAAAGTGGCTTGAAACGGCTCTCGCTGTCGGACCACACCAAA
TCTCCAAGCACAGATCCGTCCCCTAGTCCGTTCAAAAGACAAAAGAGCGCGGAAACCCCGGTACCAATCCCGCGC
GACTCCTTTCCTCGGCATACAGAAAAGCCCAATCCAGGCGATGCTGAGAAGATGGCCGGGGAAGGGGATAACGCG
GGGGCGGTTACGGAAACAAATTCCCGCTTCACAGAGACTGGCGGTGGTGAAATGGCGGCCGCCATTCCCACAGCT
GGGCCGTCTGCCTTCGCCTGTACTCTCCTTGGCTCTGCTCCAGACTGGCGTCAAGCAAACAGGCCCGATTCGTTC
CCAATGCCATATGCGTCCTCGTCCGCCTTCCTCGCTTCAGCATTCACAGAGCCAAGCCCGGACGACATTGTGCTC
GCAGCTCAGGCGAAAGGTTCGAACTTTGCGCGGGCAAAATGATGGAGCTAATTCTAATGTTGGTTTCAGCGGGAA
AGAAGCCTGCAACGACACCCAAGGCTGTGAAGAAAACGGCATCCAACGATGCCAAAAAGCAAGCGGAGCTCACGA
GCTCCGTTTCTGGTCTCAAAATCAACGACGCTCCCCCTCCAAAGAGCAAGGGCCTCGACGTTATTAAAGAATTCG
AAAATGGCACCGTCAAAAAGAGCACGAGCTTCGTCGTGGTGGGTGCGTGGTGAAGTAAAAAAAAAACACCCGCTG
ATCAGGTCAAGGTACTGACGCCCCGAAATAGGGCACGTGGACGCCGGCAAGAGTACGCTCATGGGTCGCCTCCTG
TTGGAACTAAAATTTGTCGAGCAGCGTACGGTGGAAAAGTATCGAAGGCAGGCCGAGAAGAGCGGCAAGCAGTCG
TTCGCCCTCGCTTGGGTTATGGACCAAGGAAGTGAGGAGCGGGACCGTGGTGTGACGATTGACATTGCGACAAAC
CACTTCGAGACTCCGACAACGAAATTTACGATCCTGGACGCACCGGGACATCGAGACTTTGTTCCGAACATGATC
GCCGGCGCCAGCCAGGCTGACCTTGCCATCCTGGTCATTGACGCGAATACGGGCGCTTTCGAGAGGGGTCTCAAG
GGGCAAACCCGAGAGCACGTTCTTCTCCTGCGAAGCTTAGGCGTTCAGCGCCTCATCGTGGCGGTGAACAAGCTT
GACACGGTGGATTGGTCCAAAGAACGCTTCGACGAAATCTCTGGGCAGGTCAACGGGTTTCTCACCGGCCTGGGG
TTCCAAAGCAAGCACGTGAGCTTCGTCCCAATCTCGGGTCTGAACGGGGACAATATCGCTCGTAAGATAGAGAGC
CCAGCGGCGAGCTGGTACCTGGGCCCCACCCTGATGGAAGCGCTGGAGACGACAGGGCCAACTGCCACACGAGCG
CTAGGGAAACCTTTCAGGATGCCGATTTCCGAGGTATTCAGGTCCCAGCAGGGGACGACCACGCTGGCTGGCCGA
ATCGAGTCGGGAACGGTACAGATCGGCGACAGCGTTGTCGTGCAACCCAGCGGAGAGTCGGCTTACATCAAATCG
ATCGTCGTGGACACGGACGCGCAGGACTGGGCGGTGGCGGGACAGAGCGTTAGCATCGCCCTGACGAACATCGAC
CCCATCCACATCAGGGTGGGCGACATCGTCTGTGACGCTAGAGACCCAATCAAGTGCGGCGACACCTTCACCATC
AAGGCCATGGCTTTCGACCACTTGATGCCGATGCCGGTGGATCTGCACCGCGGCCGCCTGCACACACCAGGTCAG
ATACAGTCTATTGCGGCAGTCCTCGACAAAGCGACCGGCGAGGTTGTCAAGAAGAAGCCCAAGATCGTCCAACCG
GGCGGGGTGGCCCGGATGTCGATCAAGCTGAGCTCCAAGGTTCCGTTGGAGGCCGGACACCGAGTGGTGATACGG
AGCGGAGGAGAGACAATCGCGGCAGGATTGCTGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail