Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10435
Gene name
LocationContig_842:6350..11177
Strand-
Gene length (bp)4827
Transcript length (bp)3825
Coding sequence length (bp)3825
Protein length (aa) 1275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02854 MIF4G MIF4G domain 5.0E-54 889 1131
PF12152 eIF_4G1 Eukaryotic translation initiation factor 4G1 8.7E-22 640 712

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10475|IF4G_SCHPO Eukaryotic translation initiation factor 4 gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif471 PE=1 SV=1 845 1184 1.0E-106
sp|P39936|IF4F2_YEAST Eukaryotic initiation factor 4F subunit p130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF4632 PE=1 SV=1 825 1225 2.0E-69
sp|P39935|IF4F1_YEAST Eukaryotic initiation factor 4F subunit p150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF4631 PE=1 SV=2 651 1160 3.0E-64
sp|O43432|IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens GN=EIF4G3 PE=1 SV=2 829 1207 2.0E-54
sp|Q80XI3|IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus GN=Eif4g3 PE=1 SV=2 758 1207 3.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10475|IF4G_SCHPO Eukaryotic translation initiation factor 4 gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif471 PE=1 SV=1 845 1184 1.0E-106
sp|P39936|IF4F2_YEAST Eukaryotic initiation factor 4F subunit p130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF4632 PE=1 SV=1 825 1225 2.0E-69
sp|P39935|IF4F1_YEAST Eukaryotic initiation factor 4F subunit p150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF4631 PE=1 SV=2 651 1160 3.0E-64
sp|O43432|IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens GN=EIF4G3 PE=1 SV=2 829 1207 2.0E-54
sp|Q80XI3|IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus GN=Eif4g3 PE=1 SV=2 758 1207 3.0E-54
sp|Q04637|IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens GN=EIF4G1 PE=1 SV=4 863 1181 6.0E-49
sp|Q6NZJ6|IF4G1_MOUSE Eukaryotic translation initiation factor 4 gamma 1 OS=Mus musculus GN=Eif4g1 PE=1 SV=1 829 1181 9.0E-49
sp|B9FXV5|IF4G_ORYSJ Eukaryotic translation initiation factor 4G OS=Oryza sativa subsp. japonica GN=Os07g0555200 PE=2 SV=2 854 1175 9.0E-46
sp|G5CEW6|IF4G_WHEAT Eukaryotic translation initiation factor 4G OS=Triticum aestivum PE=1 SV=1 854 1162 6.0E-44
sp|Q76E23|IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana GN=EIF4G PE=1 SV=2 889 1174 1.0E-42
sp|P41110|IF4G1_RABIT Eukaryotic translation initiation factor 4 gamma 1 OS=Oryctolagus cuniculus GN=EIF4G1 PE=1 SV=1 864 1181 7.0E-41
sp|Q03387|IF4G1_WHEAT Eukaryotic translation initiation factor isoform 4G-1 OS=Triticum aestivum PE=1 SV=2 888 1174 2.0E-39
sp|Q41583|IF4G2_WHEAT Eukaryotic translation initiation factor isoform 4G-2 OS=Triticum aestivum PE=2 SV=1 888 1174 3.0E-38
sp|Q553R3|IF4G_DICDI Eukaryotic translation initiation factor 4 gamma OS=Dictyostelium discoideum GN=eif4g PE=3 SV=1 859 1151 6.0E-38
sp|O82233|IF4G2_ARATH Eukaryotic translation initiation factor isoform 4G-2 OS=Arabidopsis thaliana GN=EIF(ISO)4G2 PE=1 SV=1 881 1154 6.0E-37
sp|Q62448|IF4G2_MOUSE Eukaryotic translation initiation factor 4 gamma 2 OS=Mus musculus GN=Eif4g2 PE=1 SV=2 888 1153 9.0E-37
sp|Q5R7J9|IF4G2_PONAB Eukaryotic translation initiation factor 4 gamma 2 OS=Pongo abelii GN=EIF4G2 PE=2 SV=2 888 1153 9.0E-37
sp|P78344|IF4G2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens GN=EIF4G2 PE=1 SV=1 888 1153 9.0E-37
sp|Q95L46|IF4G2_BOVIN Eukaryotic translation initiation factor 4 gamma 2 OS=Bos taurus GN=EIF4G2 PE=2 SV=2 888 1153 9.0E-37
sp|P79398|IF4G2_RABIT Eukaryotic translation initiation factor 4 gamma 2 OS=Oryctolagus cuniculus GN=EIF4G2 PE=2 SV=1 888 1153 1.0E-36
sp|Q93ZT6|IF4G1_ARATH Eukaryotic translation initiation factor isoform 4G-1 OS=Arabidopsis thaliana GN=EIF(ISO)4G1 PE=1 SV=1 888 1154 1.0E-34
sp|Q84PB3|IF4G1_ORYSJ Eukaryotic translation initiation factor isoform 4G-1 OS=Oryza sativa subsp. japonica GN=Os04g0499300 PE=2 SV=2 888 1174 2.0E-34
sp|Q6K641|IF4G2_ORYSJ Eukaryotic translation initiation factor isoform 4G-2 OS=Oryza sativa subsp. japonica GN=Os02g0611500 PE=2 SV=1 886 1154 8.0E-33
sp|C7G046|Y6969_DICDI von Willebrand factor A domain-containing protein DDB_G0286969 OS=Dictyostelium discoideum GN=DDB_G0286969 PE=3 SV=1 888 1134 4.0E-22
sp|Q5Z5Q3|C3H43_ORYSJ Zinc finger CCCH domain-containing protein 43 OS=Oryza sativa subsp. japonica GN=Os06g0520600 PE=2 SV=1 888 1065 2.0E-07
sp|Q9H074|PAIP1_HUMAN Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens GN=PAIP1 PE=1 SV=1 892 1134 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10435
MTSPANRQNSIPATNTSATTAASYASAAGAPKKSVPAPIVAISAQPPAAVAGASAFPAQNAKAASPSPVNGKSAI
TPAVPAVARGSLAANGSVADHTRKSSVTMAASGPNSYAANGGPVGGSKSGIQSNFPPQGGRGRGGFNPHGNSYNN
QMGFPPNNQFRNGPGQGRGMPPSFQPQPRSMPYPNSPQPSRSPALVPSMPNTPNMASANMQPNMTMQTPPQYHYP
PPMAPQHQNFGYPPQQMDQYGRPMSMPYGYNNMPYIAPPQANTPGYGQQYGPPPYHPQGHSMSRSPSQPERPSSA
SHQSQPVIVSSNTQPQSTQPNPAAKNFIKPGRKSAAIQIKNAAGEVVDTSSFKQPASPAPSVQQSKTPPVVSSTP
TPPPKSSTPAHGRTDSQATPKTAKEIQDELKEKIKQATQASAESKPKDDKPVSSKEQSTADVSASAAAVTDPSSD
KEEVLPAAETPKDDTPAAKAPEPEKPKDAKPAEAVESDELEEDEMERMIREMEEADLQREKEEEEHRKRKEAEKA
AAKKKEEEDRKANAADADRKLREQEREMERLEEEKEKRQKESDTSGKALSVTAALAQLRSGKDSDLSTVDAVSDK
LVDIKLEGEKPSPAADGSGQKPTTAEKRGSKPAALNLAPLNTKPVEPAQPSAALQSLKSARFLQVMDQEIYPAGI
HSPNPALNAAVTKKGKTFKYDASFLLQFKQVFTEQPSVEFHQQVKSLIGDGDGGRSARAQTPGSARQGSRGGGAA
FSMGTFAPPVRTLPPGTTSTERMAMASGTMPRPPVNSIGSFQRPGAPFPTSTPMSRTSSQSNMRNMPNSPRQSSR
STRGSRRNDFGAKEAQAAKTMPLTAGQEIKPIAISAGGWKPSSVGKASQPGPSGSAYLDPEMVQRKVKAALNKMT
PEKFDRIADQILDIASQSKDESDGRTLRQVIQLTFEKATDEAHWASMYAKFCKRMLETMSPEVRDERIKDKNGHV
VSGGNLFRKYLLNRCQEEFERGWTTLPEQKEAEESVDKKPGEAVMLSDEYYAAAAAKRRGLGLVQFIGELYKLGM
LTERIMHECVHKLVDYKGVPDEAEIESLCKLLRTIGANLDHTEKGRPMMDAYFQRIQTMAELPELQSRMKFMLMD
VIDLRRASWISKEANKGPKTLDEVRAEAEAAQAAKAQEAARNSQRGGGGRPMVGRGDARNFSAGYVQQTSNQVGM
DDLRRLKGSASRPGEDSGASSRTGTPPTRDSTTNSNAFSLLANMETEHPASPPSAGPSPSLSKAVPDGDKKESE*
Coding >Hirsu2|10435
ATGACGTCGCCTGCGAACCGGCAGAACTCCATCCCGGCGACCAACACCTCTGCGACTACGGCTGCTTCTTATGCC
TCAGCTGCAGGTGCGCCGAAGAAGTCCGTCCCGGCGCCCATAGTTGCCATCAGCGCTCAGCCTCCCGCCGCGGTC
GCCGGCGCTTCTGCCTTCCCTGCGCAGAATGCCAAGGCCGCCTCACCGTCTCCTGTGAACGGCAAGTCAGCCATC
ACCCCTGCAGTCCCTGCCGTCGCCCGTGGCAGCCTTGCTGCCAACGGGTCCGTCGCGGACCACACGCGAAAGAGC
TCCGTCACCATGGCCGCCAGCGGCCCCAACAGTTACGCCGCCAATGGCGGCCCCGTCGGGGGCTCCAAGTCAGGC
ATCCAAAGCAACTTTCCACCCCAGGGCGGCCGCGGCCGCGGCGGCTTCAACCCGCACGGCAACTCGTACAACAAT
CAGATGGGCTTCCCCCCTAACAACCAGTTCCGAAACGGCCCTGGCCAAGGCCGAGGCATGCCTCCTTCCTTTCAG
CCTCAGCCTCGAAGCATGCCGTATCCCAACTCTCCGCAGCCGAGTCGAAGCCCTGCACTCGTCCCGTCGATGCCG
AACACGCCCAATATGGCCTCGGCAAATATGCAGCCGAACATGACTATGCAAACGCCGCCACAATACCACTACCCG
CCGCCGATGGCCCCCCAACATCAAAACTTCGGGTATCCGCCCCAGCAGATGGACCAGTACGGCCGGCCAATGTCC
ATGCCTTATGGGTACAACAACATGCCGTACATTGCTCCCCCGCAGGCTAATACACCAGGATACGGGCAGCAATAT
GGCCCCCCCCCCTATCATCCTCAGGGTCATAGCATGTCCCGGAGTCCTTCGCAGCCCGAGCGACCCTCAAGCGCC
AGCCACCAGAGCCAGCCCGTCATTGTGTCCTCCAACACCCAACCTCAGAGTACCCAGCCGAACCCGGCTGCCAAG
AACTTCATCAAGCCCGGCAGAAAAAGCGCGGCGATTCAGATCAAGAACGCTGCCGGTGAGGTGGTCGACACATCG
TCGTTCAAACAACCTGCTTCCCCCGCCCCCAGTGTTCAGCAGTCCAAGACTCCTCCCGTCGTCTCCTCCACCCCT
ACCCCTCCTCCCAAATCCTCCACACCGGCTCACGGGCGAACCGACAGCCAGGCAACGCCCAAGACGGCCAAGGAA
ATACAGGACGAGCTCAAGGAGAAGATTAAGCAGGCGACCCAGGCTTCTGCTGAGAGCAAACCCAAGGATGATAAG
CCCGTGTCTTCCAAGGAACAGTCGACTGCCGACGTTTCTGCCTCGGCTGCGGCCGTGACCGATCCCAGCTCGGAC
AAGGAGGAAGTACTTCCCGCGGCTGAGACCCCGAAAGATGACACTCCCGCTGCCAAGGCCCCTGAGCCTGAGAAG
CCCAAAGACGCCAAGCCTGCTGAGGCTGTTGAGAGTGATGAACTCGAAGAGGACGAGATGGAGCGAATGATCCGT
GAGATGGAAGAGGCTGATCTTCAGCGCGAAAAGGAGGAAGAGGAGCATCGCAAGCGGAAGGAGGCCGAAAAGGCC
GCGGCCAAGAAAAAAGAGGAAGAGGATCGCAAGGCCAACGCCGCAGACGCAGATCGCAAGCTACGAGAGCAAGAG
CGCGAGATGGAGCGATTGGAGGAGGAGAAGGAGAAACGGCAGAAGGAATCGGACACTTCCGGGAAGGCCCTATCT
GTTACCGCTGCACTCGCTCAGCTGCGATCTGGCAAGGATTCCGATTTGTCCACCGTGGACGCCGTCTCAGACAAA
TTGGTGGACATCAAGCTGGAAGGAGAGAAGCCGTCGCCGGCTGCTGACGGCTCAGGCCAGAAACCCACCACGGCC
GAGAAGCGTGGGTCCAAGCCAGCTGCTCTGAATCTTGCGCCTCTCAACACAAAGCCCGTGGAGCCGGCCCAGCCG
AGCGCTGCCCTTCAGTCGCTCAAGTCGGCGCGTTTCCTGCAGGTCATGGACCAGGAAATTTACCCTGCGGGTATC
CACTCGCCAAACCCAGCTCTGAACGCTGCCGTCACCAAGAAAGGGAAGACGTTCAAGTATGACGCGAGCTTCCTG
CTGCAGTTCAAGCAGGTCTTTACCGAGCAGCCCTCGGTTGAGTTCCACCAGCAAGTCAAATCTCTCATCGGAGAT
GGCGATGGCGGTCGCTCGGCCCGGGCGCAAACGCCAGGATCGGCCCGACAAGGGTCTCGTGGCGGCGGCGCGGCC
TTCTCCATGGGCACGTTTGCACCGCCTGTGCGAACGCTGCCGCCTGGAACGACATCTACCGAGCGCATGGCCATG
GCCAGTGGTACCATGCCGCGTCCTCCGGTCAACTCGATCGGGTCTTTCCAGCGCCCCGGTGCGCCCTTCCCGACG
TCGACGCCCATGTCTCGCACCTCTTCACAGTCCAACATGCGGAACATGCCTAATTCCCCACGTCAGTCGAGCCGA
TCGACTCGTGGCAGTCGACGGAACGATTTTGGCGCCAAGGAGGCCCAGGCTGCTAAGACCATGCCTCTGACCGCT
GGCCAAGAGATCAAGCCCATTGCCATATCCGCCGGTGGCTGGAAGCCGAGCAGCGTGGGCAAGGCCAGCCAGCCT
GGACCATCCGGCAGTGCTTATCTGGACCCTGAGATGGTTCAGAGAAAGGTCAAGGCTGCGCTGAATAAAATGACT
CCCGAGAAGTTTGATCGGATCGCCGACCAGATCCTCGACATTGCTTCGCAGTCGAAGGACGAGTCTGATGGTCGC
ACACTGCGCCAGGTCATCCAGCTCACATTTGAAAAGGCAACGGATGAAGCCCATTGGGCCTCGATGTACGCCAAG
TTCTGCAAGCGAATGTTGGAGACCATGAGCCCCGAGGTACGGGATGAACGCATCAAAGACAAGAATGGACACGTC
GTCAGCGGCGGCAACCTATTTCGCAAGTATCTGCTCAACAGGTGTCAAGAAGAGTTTGAACGTGGCTGGACTACG
CTGCCGGAGCAGAAGGAGGCCGAGGAGAGCGTCGACAAAAAGCCGGGTGAGGCTGTCATGCTGTCCGACGAGTAC
TACGCCGCCGCAGCCGCCAAGCGAAGGGGACTTGGTCTCGTCCAGTTCATCGGTGAACTATATAAGCTGGGCATG
CTTACCGAGCGCATCATGCACGAATGCGTCCATAAGCTTGTTGACTACAAGGGCGTGCCTGACGAGGCTGAGATC
GAGTCGCTCTGCAAGCTGCTCCGAACGATTGGCGCCAACCTTGATCACACCGAGAAGGGTCGCCCGATGATGGAC
GCCTACTTCCAACGGATTCAGACTATGGCTGAATTGCCAGAGCTTCAAAGTCGCATGAAGTTCATGCTCATGGAT
GTCATCGACCTGCGAAGGGCGAGCTGGATATCCAAGGAGGCGAACAAGGGACCCAAGACTTTGGACGAGGTTCGC
GCAGAGGCTGAAGCGGCACAGGCAGCGAAAGCGCAGGAGGCAGCCCGAAACAGCCAGAGAGGGGGCGGCGGTCGC
CCAATGGTGGGACGGGGCGACGCTCGCAACTTCTCGGCCGGCTACGTTCAGCAAACCAGCAATCAGGTCGGCATG
GACGACCTGAGGCGCCTCAAGGGCTCTGCGAGCCGTCCCGGCGAAGACTCAGGAGCTTCTTCGCGCACCGGCACT
CCTCCTACCAGAGACAGCACTACGAACTCTAACGCATTCAGTCTGTTGGCAAATATGGAAACCGAGCATCCAGCC
TCGCCTCCATCCGCAGGACCCTCTCCATCCTTGTCGAAAGCTGTGCCCGACGGCGACAAGAAGGAGAGCGAATAG
Transcript >Hirsu2|10435
ATGACGTCGCCTGCGAACCGGCAGAACTCCATCCCGGCGACCAACACCTCTGCGACTACGGCTGCTTCTTATGCC
TCAGCTGCAGGTGCGCCGAAGAAGTCCGTCCCGGCGCCCATAGTTGCCATCAGCGCTCAGCCTCCCGCCGCGGTC
GCCGGCGCTTCTGCCTTCCCTGCGCAGAATGCCAAGGCCGCCTCACCGTCTCCTGTGAACGGCAAGTCAGCCATC
ACCCCTGCAGTCCCTGCCGTCGCCCGTGGCAGCCTTGCTGCCAACGGGTCCGTCGCGGACCACACGCGAAAGAGC
TCCGTCACCATGGCCGCCAGCGGCCCCAACAGTTACGCCGCCAATGGCGGCCCCGTCGGGGGCTCCAAGTCAGGC
ATCCAAAGCAACTTTCCACCCCAGGGCGGCCGCGGCCGCGGCGGCTTCAACCCGCACGGCAACTCGTACAACAAT
CAGATGGGCTTCCCCCCTAACAACCAGTTCCGAAACGGCCCTGGCCAAGGCCGAGGCATGCCTCCTTCCTTTCAG
CCTCAGCCTCGAAGCATGCCGTATCCCAACTCTCCGCAGCCGAGTCGAAGCCCTGCACTCGTCCCGTCGATGCCG
AACACGCCCAATATGGCCTCGGCAAATATGCAGCCGAACATGACTATGCAAACGCCGCCACAATACCACTACCCG
CCGCCGATGGCCCCCCAACATCAAAACTTCGGGTATCCGCCCCAGCAGATGGACCAGTACGGCCGGCCAATGTCC
ATGCCTTATGGGTACAACAACATGCCGTACATTGCTCCCCCGCAGGCTAATACACCAGGATACGGGCAGCAATAT
GGCCCCCCCCCCTATCATCCTCAGGGTCATAGCATGTCCCGGAGTCCTTCGCAGCCCGAGCGACCCTCAAGCGCC
AGCCACCAGAGCCAGCCCGTCATTGTGTCCTCCAACACCCAACCTCAGAGTACCCAGCCGAACCCGGCTGCCAAG
AACTTCATCAAGCCCGGCAGAAAAAGCGCGGCGATTCAGATCAAGAACGCTGCCGGTGAGGTGGTCGACACATCG
TCGTTCAAACAACCTGCTTCCCCCGCCCCCAGTGTTCAGCAGTCCAAGACTCCTCCCGTCGTCTCCTCCACCCCT
ACCCCTCCTCCCAAATCCTCCACACCGGCTCACGGGCGAACCGACAGCCAGGCAACGCCCAAGACGGCCAAGGAA
ATACAGGACGAGCTCAAGGAGAAGATTAAGCAGGCGACCCAGGCTTCTGCTGAGAGCAAACCCAAGGATGATAAG
CCCGTGTCTTCCAAGGAACAGTCGACTGCCGACGTTTCTGCCTCGGCTGCGGCCGTGACCGATCCCAGCTCGGAC
AAGGAGGAAGTACTTCCCGCGGCTGAGACCCCGAAAGATGACACTCCCGCTGCCAAGGCCCCTGAGCCTGAGAAG
CCCAAAGACGCCAAGCCTGCTGAGGCTGTTGAGAGTGATGAACTCGAAGAGGACGAGATGGAGCGAATGATCCGT
GAGATGGAAGAGGCTGATCTTCAGCGCGAAAAGGAGGAAGAGGAGCATCGCAAGCGGAAGGAGGCCGAAAAGGCC
GCGGCCAAGAAAAAAGAGGAAGAGGATCGCAAGGCCAACGCCGCAGACGCAGATCGCAAGCTACGAGAGCAAGAG
CGCGAGATGGAGCGATTGGAGGAGGAGAAGGAGAAACGGCAGAAGGAATCGGACACTTCCGGGAAGGCCCTATCT
GTTACCGCTGCACTCGCTCAGCTGCGATCTGGCAAGGATTCCGATTTGTCCACCGTGGACGCCGTCTCAGACAAA
TTGGTGGACATCAAGCTGGAAGGAGAGAAGCCGTCGCCGGCTGCTGACGGCTCAGGCCAGAAACCCACCACGGCC
GAGAAGCGTGGGTCCAAGCCAGCTGCTCTGAATCTTGCGCCTCTCAACACAAAGCCCGTGGAGCCGGCCCAGCCG
AGCGCTGCCCTTCAGTCGCTCAAGTCGGCGCGTTTCCTGCAGGTCATGGACCAGGAAATTTACCCTGCGGGTATC
CACTCGCCAAACCCAGCTCTGAACGCTGCCGTCACCAAGAAAGGGAAGACGTTCAAGTATGACGCGAGCTTCCTG
CTGCAGTTCAAGCAGGTCTTTACCGAGCAGCCCTCGGTTGAGTTCCACCAGCAAGTCAAATCTCTCATCGGAGAT
GGCGATGGCGGTCGCTCGGCCCGGGCGCAAACGCCAGGATCGGCCCGACAAGGGTCTCGTGGCGGCGGCGCGGCC
TTCTCCATGGGCACGTTTGCACCGCCTGTGCGAACGCTGCCGCCTGGAACGACATCTACCGAGCGCATGGCCATG
GCCAGTGGTACCATGCCGCGTCCTCCGGTCAACTCGATCGGGTCTTTCCAGCGCCCCGGTGCGCCCTTCCCGACG
TCGACGCCCATGTCTCGCACCTCTTCACAGTCCAACATGCGGAACATGCCTAATTCCCCACGTCAGTCGAGCCGA
TCGACTCGTGGCAGTCGACGGAACGATTTTGGCGCCAAGGAGGCCCAGGCTGCTAAGACCATGCCTCTGACCGCT
GGCCAAGAGATCAAGCCCATTGCCATATCCGCCGGTGGCTGGAAGCCGAGCAGCGTGGGCAAGGCCAGCCAGCCT
GGACCATCCGGCAGTGCTTATCTGGACCCTGAGATGGTTCAGAGAAAGGTCAAGGCTGCGCTGAATAAAATGACT
CCCGAGAAGTTTGATCGGATCGCCGACCAGATCCTCGACATTGCTTCGCAGTCGAAGGACGAGTCTGATGGTCGC
ACACTGCGCCAGGTCATCCAGCTCACATTTGAAAAGGCAACGGATGAAGCCCATTGGGCCTCGATGTACGCCAAG
TTCTGCAAGCGAATGTTGGAGACCATGAGCCCCGAGGTACGGGATGAACGCATCAAAGACAAGAATGGACACGTC
GTCAGCGGCGGCAACCTATTTCGCAAGTATCTGCTCAACAGGTGTCAAGAAGAGTTTGAACGTGGCTGGACTACG
CTGCCGGAGCAGAAGGAGGCCGAGGAGAGCGTCGACAAAAAGCCGGGTGAGGCTGTCATGCTGTCCGACGAGTAC
TACGCCGCCGCAGCCGCCAAGCGAAGGGGACTTGGTCTCGTCCAGTTCATCGGTGAACTATATAAGCTGGGCATG
CTTACCGAGCGCATCATGCACGAATGCGTCCATAAGCTTGTTGACTACAAGGGCGTGCCTGACGAGGCTGAGATC
GAGTCGCTCTGCAAGCTGCTCCGAACGATTGGCGCCAACCTTGATCACACCGAGAAGGGTCGCCCGATGATGGAC
GCCTACTTCCAACGGATTCAGACTATGGCTGAATTGCCAGAGCTTCAAAGTCGCATGAAGTTCATGCTCATGGAT
GTCATCGACCTGCGAAGGGCGAGCTGGATATCCAAGGAGGCGAACAAGGGACCCAAGACTTTGGACGAGGTTCGC
GCAGAGGCTGAAGCGGCACAGGCAGCGAAAGCGCAGGAGGCAGCCCGAAACAGCCAGAGAGGGGGCGGCGGTCGC
CCAATGGTGGGACGGGGCGACGCTCGCAACTTCTCGGCCGGCTACGTTCAGCAAACCAGCAATCAGGTCGGCATG
GACGACCTGAGGCGCCTCAAGGGCTCTGCGAGCCGTCCCGGCGAAGACTCAGGAGCTTCTTCGCGCACCGGCACT
CCTCCTACCAGAGACAGCACTACGAACTCTAACGCATTCAGTCTGTTGGCAAATATGGAAACCGAGCATCCAGCC
TCGCCTCCATCCGCAGGACCCTCTCCATCCTTGTCGAAAGCTGTGCCCGACGGCGACAAGAAGGAGAGCGAATAG
Gene >Hirsu2|10435
ATGACGTCGCCTGCGAACCGGCAGAACTCCATCCCGGCGACCAACACCTCTGCGACTACGGCTGCTTCTTATGCC
TCAGCTGCAGGTGCGCCGAAGAAGTCCGTCCCGGCGCCCATAGTTGCCATCAGCGCTCAGCCTCCCGCCGCGGTC
GCCGGCGCTTCTGCCTTCCCTGCGCAGAATGCCAAGGCCGCCTCACCGTCTCCTGTGAACGGCAAGTCAGCCATC
ACCCCTGCAGTCCCTGCCGTCGCCCGTGGCAGCCTTGCTGCCAACGGGTCCGTCGCGGACCACACGCGAAAGAGC
TCCGTCACCATGGCCGCCAGCGGCCCCAACAGTTACGCCGCCAATGGCGGCCCCGTCGGGGGCTCCAAGTCAGGC
ATCCAGTTCGGATTCGATTCGCCCGCCATGGCTCACAGCACTCCCCAGGATGGCACCTCGGCTCCCATTCCCATC
CCCGGCGGGAATCCGCGTGTCACCTCTCCCGCCCAATCTCCTTCGCCCATACCACAGCCATCGGCAAGCGGCGGT
CGCCCTCCCTCCGGACTTCAGCAGCCCACCGGTCAAATGACTTTTGGAAGTCTGAGCAGCGATGGCGAAGTTAGT
AGTCACCCTCCCATCCCCCTCCCCCCAAACACTCGAGCGCTGCTCAGCAATCCCCCTCTTCCCGCACTATCTTGC
CTCGGCTCCCGTCAAAAACGCTCACAATACTTGCAGCGCCACATAAGACAGTGCTCGGTCCCTCAAAACCCCAAC
CCGATGGCTTCGCAGACTGGCGCCCATTTCCGACGCGAATCTGGCCATTCCGTCCCTGGTGACAATCCCGGGGCT
CCAAACAGAAGCAACTTTCCACCCCAGGGCGGCCGCGGCCGCGGCGGCTTCAACCCGCACGGCAACTCGTACAAC
AATCAGATGGGCTTCCCCCCTAACAACCAGTTCCGAAACGGCCCTGGCCAAGGCCGAGGCATGCCTCCTTCCTTT
CAGCCTCAGCCTCGAAGCATGCCGTATCCCAACTCTCCGCAGCCGAGTCGAAGCCCTGCACTCGTCCCGTCGATG
CCGAACACGCCCAATATGGCCTCGGCAAATATGCAGCCGAACATGACTATGCAAACGCCGCCACAATACCACTAC
CCGCCGCCGATGGCCCCCCAACATCAAGTACATCTCCCCTTCCCCGTTTATCCCTCTAAGAAAATATACCTCCTA
GCCCCCACGAAGGCCAAGGCTCGCCGTGAGCTGGACAAGCCTGTTTATATGGGGCGTCAGCGGGATTCTGCACAT
GGGCCATTCGGCCACTATGCTCAGCAGCATCCTCGCCGTCGCTTTGAACTGGCGGACCAGGGGCAGCGTCAGCTT
GACATGTGCGCAGTCTCCAATGTCTCTTGGGGCCTCTCTGAAGCACAACGAACTCATCCTGTCCCCGTCCCTCTT
GACCTCTCTCCAGAAAATGGAGGATTTGAGCTTTGGCTGACTTTGAGAAATCAGAACTTCGGGTATCCGCCCCAG
CAGATGGACCAGTACGGCCGGCCAATGTCCATGCCTTATGGGTACAACAACATGCCGTACATTGCTCCCCCGCAG
GCTAATACACCAGGATACGGGCAGCAATATGGCCCCCCCCCCTATCATCCTCAGGGTCATAGCATGTCCCGGAGT
CCTTCGCAGCCCGAGCGACCCTCAAGCGCCAGCCACCAGAGCCAGCCCGTCATTGTGTCCTCCAACACCCAACCT
CAGAGTACCCAGCCGAACCCGGCTGCCAAGAACTTCATCAAGCCCGGCAGAAAAAGCGCGGCGATTCAGATCAAG
AACGCTGCCGGTGAGGTGGTCGACACATCGTCGTTCAAACAACCTGCTTCCCCCGCCCCCAGTGTTCAGCAGTCC
AAGACTCCTCCCGTCGTCTCCTCCACCCCTACCCCTCCTCCCAAATCCTCCACACCGGCTCACGGGCGAACCGAC
AGCCAGGCAACGCCCAAGACGGCCAAGGAAATACAGGACGAGCTCAAGGAGAAGATTAAGCAGGCGACCCAGGCT
TCTGCTGAGAGCAAACCCAAGGATGATAAGCCCGTGTCTTCCAAGGAACAGTCGACTGCCGACGTTTCTGCCTCG
GCTGCGGCCGTGACCGATCCCAGCTCGGACAAGGAGGAAGTACTTCCCGCGGCTGAGACCCCGAAAGATGACACT
CCCGCTGCCAAGGCCCCTGAGCCTGAGAAGCCCAAAGACGCCAAGCCTGCTGAGGCTGTTGAGAGTGATGAACTC
GAAGAGGACGAGATGGAGCGAATGATCCGTGAGATGGAAGAGGCTGATCTTCAGCGCGAAAAGGAGGAAGAGGAG
CATCGCAAGCGGAAGGAGGCCGAAAAGGCCGCGGCCAAGAAAAAAGAGGAAGAGGATCGCAAGGCCAACGCCGCA
GACGCAGATCGCAAGCTACGAGAGCAAGAGCGCGAGATGGAGCGATTGGAGGAGGAGAAGGAGAAACGGCAGAAG
GAATCGGACACTTCCGGGAAGGCCCTATCTGTTACCGCTGCACTCGCTCAGCTGCGATCTGGCAAGGATTCCGAT
TTGTCCACCGTGGACGCCGTCTCAGACAAATTGGTGGACATCAAGCTGGAAGGAGAGAAGCCGTCGCCGGCTGCT
GACGGCTCAGGCCAGAAACCCACCACGGCCGAGAAGCGTGGGTCCAAGCCAGCTGCTCTGAATCTTGCGCCTCTC
AACACAAAGCCCGTGGAGCCGGCCCAGCCGAGCGCTGCCCTTCAGTCGCTCAAGTCGGCGCGTTTCCTGCAGGTC
ATGGACCAGGAAATTTACCCTGCGGGTATCCACTCGCCAAACCCAGCTCTGAACGCTGCCGTCACCAAGAAAGGG
AAGACGTTCAAGTATGACGCGAGCTTCCTGCTGCAGTTCAAGCAGGTCTTTACCGAGCAGCCCTCGGTTGAGTTC
CACCAGCAAGTCAAATCTCTCATCGGAGATGGCGATGGCGGTCGCTCGGCCCGGGCGCAAACGCCAGGATCGGCC
CGACAAGGGTCTCGTGGCGGCGGCGCGGCCTTCTCCATGGGCACGTTTGCACCGCCTGTGCGAACGCTGCCGCCT
GGAACGACATCTACCGAGCGCATGGCCATGGCCAGTGGTACCATGCCGCGTCCTCCGGTCAACTCGATCGGGTCT
TTCCAGCGCCCCGGTGCGCCCTTCCCGACGTCGACGCCCATGTCTCGCACCTCTTCACAGTCCAACATGCGGAAC
ATGCCTAATTCCCCACGTCAGTCGAGCCGATCGACTCGTGGCAGTCGACGGAACGATTTTGGCGCCAAGGAGGCC
CAGGCTGCTAAGACCATGCCTCTGACCGCTGGCCAAGAGATCAAGCCCATTGCCATATCCGCCGGTGGCTGGAAG
CCGAGCAGCGTGGGCAAGGCCAGCCAGCCTGGACCATCCGGCAGTGCTTATCTGGACCCTGAGATGGTTCAGAGA
AAGGTCAAGGCTGCGCTGAATAAAATGACTCCCGAGAAGTTTGATCGGATCGCCGACCAGATCCTCGACATTGCT
TCGCAGTCGAAGGACGAGTCTGATGGTCGCACACTGCGCCAGGTCATCCAGCTCACATTTGAAAAGGCAACGGAT
GAAGCCCATTGGGCCTCGATGTACGCCAAGTTCTGCAAGCGAATGTTGGAGACCATGAGCCCCGAGGTACGGGAT
GAACGCATCAAAGACAAGAATGGACACGTCGTCAGCGGCGGCAACCTATTTCGCAAGTATCTGCTCAACAGGTGT
CAAGAAGAGTTTGAACGTGGCTGGACTACGCTGCCGGAGCAGAAGGAGGCCGAGGAGAGCGTCGACAAAAAGCCG
GGTGAGGCTGTCATGCTGTCCGACGAGTACTACGCCGCCGCAGCCGCCAAGCGAAGGGGACTTGGTCTCGTCCAG
TTCATCGGTGAACTATATAAGCTGGGCATGCTTACCGAGCGCATCATGCACGAATGCGTCCATAAGCTTGTTGAC
TACAAGGGCGTGCCTGACGAGGCTGAGATCGAGTCGCTCTGCAAGCTGCTCCGAACGATTGGCGCCAACCTTGAT
CACACCGAGAAGGGTCGCCCGATGATGGACGCCTACTTCCAACGGATTCAGACTATGGCTGAATTGCCAGAGCTT
CAAAGTCGCATGAAGTTCATGCTCATGGATGTCATCGACCTGCGAAGGGCGAGCTGGATATCCAAGGAGGCGAAC
AAGGGACCCAAGACTTTGGACGAGGTTCGCGCAGAGGTGAGAAATCATCTGAAGCCTTCACCCTCGATTGTGCAG
CCCTCTAACGCAAATATCAACAGGCTGAAGCGGCACAGGCAGCGAAAGCGCAGGAGGCAGCCCGAAACAGCCAGA
GAGGGGGCGGCGGTCGCCCAATGGTGGGACGGGGCGACGCTCGCAACTTCTCGGCCGGCTACGTTCAGCAAACCA
GCAATCAGGTCGGCATGGACGACCTGAGGCGCCTCAAGGGCTCTGCGAGTAGGACCTCCAGCCAGAACGTCACGC
TCGGACCGACATCCATGTTTTCTTCCCGCAGCAACAGTGGAAGGCGCCTTGGTCCGGGGGGTTCCTTAGGCCGTC
CCGGCGAAGACTCAGGAGCTTCTTCGCGCACCGGCACTCCTCCTACCAGAGACAGCACTACGAACTCTAACGCAT
TCAGGTAAGGACCTTCTCCGCCCAAGCGGCTTCCGGCCGCCTCAGGTTACTGACGTCGGATCTTTCAGTCTGTTG
GCAAATATGGAAACCGAGCATCCAGCCTCGCCTCCATCCGCAGGACCCTCTCCATCCTTGTCGAAAGCTGTGCCC
GACGGCGACAAGAAGGAGAGCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail