Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10432
Gene name
LocationContig_842:455..1199
Strand+
Gene length (bp)744
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12254 DNA_pol_alpha_N DNA polymerase alpha subunit p180 N terminal 2.4E-25 10 75

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 9 156 9.0E-22
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 26 85 5.0E-07
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 8 97 5.0E-07
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 28 76 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10432
MSKANHRAKLAELRALRQSGKKAFDHYRVDDVQNLYDEVDEDGYKEIVRTRLNQDDFVVDDHGEGYADDGREEWD
RVRQDDSDSDDKELPVRGRPRKAVKESCQKEQARRAVNDRNISEYFTKGPAKSQPKPKVAKTKADGDFMADLLSE
VDYNIPASAITTRQPEAEKAGHASIPDLPPRWHPA*
Coding >Hirsu2|10432
ATGTCAAAGGCCAACCACAGGGCCAAGCTCGCCGAGCTTCGAGCTCTTCGCCAATCGGGCAAGAAAGCCTTCGAT
CACTATCGCGTTGACGATGTACAAAACCTTTATGATGAGGTTGACGAGGATGGCTACAAGGAAATTGTTCGGACG
CGGCTCAATCAGGATGATTTCGTAGTCGACGACCATGGCGAGGGTTACGCCGACGACGGTCGCGAGGAATGGGAC
CGTGTCCGACAAGATGATTCAGACAGCGATGATAAAGAACTGCCTGTACGAGGTAGGCCCAGAAAAGCCGTCAAG
GAGAGCTGTCAGAAGGAACAGGCCAGGCGTGCAGTCAACGATCGCAACATCAGCGAGTATTTCACCAAAGGGCCA
GCCAAAAGCCAACCCAAGCCCAAGGTAGCTAAAACCAAGGCAGACGGCGACTTTATGGCCGACCTTCTCTCCGAG
GTCGACTACAACATCCCCGCCTCGGCCATTACCACGAGGCAGCCCGAAGCGGAGAAAGCTGGACACGCCTCGATA
CCCGACCTTCCCCCCCGGTGGCACCCTGCATAG
Transcript >Hirsu2|10432
ATGTCAAAGGCCAACCACAGGGCCAAGCTCGCCGAGCTTCGAGCTCTTCGCCAATCGGGCAAGAAAGCCTTCGAT
CACTATCGCGTTGACGATGTACAAAACCTTTATGATGAGGTTGACGAGGATGGCTACAAGGAAATTGTTCGGACG
CGGCTCAATCAGGATGATTTCGTAGTCGACGACCATGGCGAGGGTTACGCCGACGACGGTCGCGAGGAATGGGAC
CGTGTCCGACAAGATGATTCAGACAGCGATGATAAAGAACTGCCTGTACGAGGTAGGCCCAGAAAAGCCGTCAAG
GAGAGCTGTCAGAAGGAACAGGCCAGGCGTGCAGTCAACGATCGCAACATCAGCGAGTATTTCACCAAAGGGCCA
GCCAAAAGCCAACCCAAGCCCAAGGTAGCTAAAACCAAGGCAGACGGCGACTTTATGGCCGACCTTCTCTCCGAG
GTCGACTACAACATCCCCGCCTCGGCCATTACCACGAGGCAGCCCGAAGCGGAGAAAGCTGGACACGCCTCGATA
CCCGACCTTCCCCCCCGGTGGCACCCTGCATAG
Gene >Hirsu2|10432
ATGTCAAAGGCCAACCACAGGGCCAAGCTCGCCGAGCTTCGAGCTCTTCGCCAATCGGGCAAGAAAGCCTTCGAT
CACTATCGCGTTGACGATGTACAAAACCTTTATGATGAGGTTGACGAGGATGGCTACAAGGAAATTGTTCGGACG
CGGCTCAATCAGGATGATTTCGTAGTCGACGACCATGGCGAGGGTTACGCCGACGACGGTCGCGAGGAATGGGAC
CGTGTCCGACAAGATGATTCAGACAGCGATGATAAAGAACTGCCTGTACGAGGTAGGCCCAGAAAAGCCGGTATG
TTCTCAGTCGTACTTAGGCGGCCAACCATGCCCTATCATCTTCTCACGCCTCATGATTTAGTCAAGGAGAGCTGT
CAGAAGGAACAGGCCAGGCGTGCAGTCAACGATCGCAACATCAGCGAGTATTTCACCAAAGGGCCAGCCAAAAGC
CAACCCAAGCCCAAGGTGAGCCGTGAAATTCCCTTTCACTCGTCCCTCTCCCCTCGACACGCTGACATTCAGACT
AGGTAGCTAAAACCAAGGCAGACGGCGACTTTATGGCCGACCTTCTCTCCGAGGTCGACTACAACATCCCCGCCT
CGGCCATTACCACGAGGCAGCCCGAAGCGGAGAAAGCTGGACAGTCGCGCAGACCAAGGGTCCTGTCGCCCACCC
CGGAACCGACGTTGAAGAGACAAAAGCGCCTCGATACCCGACCTTCCCCCCCGGTGGCACCCTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail