Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10431
Gene name
LocationContig_841:4918..7528
Strand-
Gene length (bp)2610
Transcript length (bp)2610
Coding sequence length (bp)2610
Protein length (aa) 870

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 4.2E-18 447 724
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 1.8E-05 595 673

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 100 122 22
3 142 164 22
4 242 264 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10431
MYSLTSPVSSARFFSRRLGLAAVSRFGDRRFAYAVAAAAVLAAKFLHVYAHLEALPEYYLTRWGPSFFTQDTVFL
LGLRLIMDVRPSITKGWLRAVTKLVVSTLVAFVTLLATISISFFMVAGLELHWRNIGTAGDSSAWRMLLTGLVSF
AVVLVGIILIASVLQNLCYLIAGIALDIVRWPVSALLSALPVRISTTSHHPEYRHVPQQDADVAVEHGLKSAEDC
PDIDVSEALPMPMPSKMVMVVLYIGVCLGLVAQLATGLLRPSDASLVFMSWTVALLPFVDFSHSSPSLDRILSAP
SAEADASAASWQRQNRTALAEPPSFRWLPNETKLAGFEDWYGPDQKHYSAADDPLKISNLDDAVLSGLDGSLDDI
KIRHVVLIKLEATRKDVFPIKKGGFIWERLAGSFKHEPMPVEAQERLATLTATANFLTGDYDDGFKHPERPRRGG
INFNNGHSTSTYTLKSLVGTLCGLTPLIADFNLEVNHHVYQPCLPHVFGALNQLRHSGDGSSSDDFTTFQWKPTF
LQSVTSSFDKQTGLMGKLGFLADDFITKESLRIGSPKFDRVTVPDINYFGMPETTLENHIRDAFSSAQQNKERVF
LTHLTSTTHHAFGLPEGEKYVPLNDEKDLDDLSHYVNAVGFVDRWLGRVLDILDAEGVVNETLVVVVGDHGLSIA
EQGSVSTYANGNIGNFHVPFVISHPGMPPIDVNDTVNSIQVLPTILDLLAETGSLSAAGTEAARDLARNYEGQSL
IRPQRNSSGPKARQVGNWQFTLINPGGSMISVRDARRPTWRLVVPIVENTEWRFTDTKSNPQEAIALVSFDFKSF
LRSIQDRHSTKASSWAEEAAFVTRWLVEENARRWHYKQNSVTNT*
Coding >Hirsu2|10431
ATGTACTCGCTCACCAGCCCCGTCTCGTCGGCTCGCTTCTTCAGCCGGCGCCTGGGCCTGGCTGCCGTCTCGCGG
TTCGGCGACCGCCGGTTCGCGTATGCCGTCGCCGCTGCCGCTGTCCTCGCCGCCAAGTTCCTACACGTCTACGCC
CATCTGGAAGCGCTGCCGGAGTACTATCTGACGCGATGGGGGCCTTCTTTCTTCACCCAGGACACCGTCTTCCTG
CTCGGCTTGCGCCTGATCATGGATGTGCGGCCGTCGATAACGAAAGGCTGGCTTCGGGCCGTCACAAAGCTCGTC
GTCTCGACTCTCGTCGCCTTCGTCACCCTCTTGGCCACCATCAGCATCTCTTTCTTCATGGTCGCCGGCCTGGAG
CTTCACTGGCGCAACATCGGCACCGCCGGCGACTCGTCGGCCTGGCGAATGCTCCTGACGGGGCTGGTCTCCTTC
GCCGTCGTCCTGGTCGGCATAATTTTGATCGCAAGCGTACTGCAGAACCTCTGCTACCTCATCGCCGGCATTGCA
CTCGATATTGTCCGCTGGCCGGTCTCGGCCCTGCTGAGTGCGCTCCCCGTACGGATATCCACGACCTCTCACCAT
CCCGAGTATCGGCACGTCCCGCAGCAGGACGCCGATGTAGCCGTCGAGCACGGACTCAAGTCGGCTGAGGACTGC
CCCGACATCGACGTCTCGGAGGCGCTTCCGATGCCGATGCCGTCCAAGATGGTCATGGTCGTGCTATATATTGGC
GTCTGCCTTGGACTCGTTGCCCAGCTCGCCACGGGCCTGTTGCGGCCCTCGGACGCTTCGCTGGTCTTCATGTCC
TGGACTGTGGCATTGTTGCCCTTTGTAGACTTCTCTCACTCCTCGCCATCGCTCGACCGGATACTCTCGGCCCCC
AGTGCCGAGGCCGACGCCAGCGCAGCGTCGTGGCAGAGGCAGAACCGCACCGCCCTTGCCGAGCCTCCCTCCTTC
CGCTGGCTCCCAAACGAAACGAAACTCGCTGGCTTCGAGGACTGGTATGGGCCAGACCAAAAGCACTACAGCGCG
GCCGACGACCCGCTCAAAATCTCCAACCTCGACGATGCTGTTCTCTCGGGCCTCGATGGCTCGCTCGACGATATC
AAGATCCGGCATGTCGTGCTAATCAAGCTCGAGGCCACCCGTAAGGACGTCTTTCCTATAAAGAAGGGCGGCTTC
ATATGGGAGCGCCTGGCGGGCTCATTCAAACACGAGCCGATGCCGGTCGAGGCGCAGGAGAGGCTGGCCACACTG
ACGGCAACCGCCAACTTTTTGACGGGCGACTACGACGACGGCTTCAAGCACCCAGAAAGGCCGCGCCGGGGTGGC
ATCAATTTTAACAACGGGCACTCGACCAGCACCTACACGTTGAAAAGTCTGGTTGGCACGCTATGCGGTTTGACG
CCCCTTATTGCTGACTTCAACCTCGAGGTTAACCACCACGTCTATCAGCCATGCCTGCCTCACGTCTTCGGAGCA
TTAAACCAGCTCAGGCACAGCGGAGACGGCAGCTCGAGTGACGATTTCACGACTTTCCAGTGGAAGCCGACCTTT
TTGCAGTCCGTCACGAGCTCGTTTGATAAGCAGACCGGCTTAATGGGAAAGCTGGGGTTTCTCGCCGATGATTTC
ATCACCAAGGAGTCCCTAAGGATCGGTTCTCCCAAGTTCGACCGCGTCACAGTCCCCGATATCAACTACTTCGGC
ATGCCCGAAACTACACTCGAGAACCATATTCGCGATGCCTTCTCGTCGGCTCAGCAAAACAAGGAACGCGTCTTC
CTCACCCACCTTACAAGCACGACGCACCACGCCTTTGGCCTCCCAGAAGGCGAAAAGTACGTGCCTCTCAACGAC
GAGAAGGATCTAGACGACTTATCGCATTACGTCAACGCCGTTGGTTTCGTCGACCGTTGGCTGGGCCGCGTGCTC
GACATCCTTGACGCTGAGGGCGTCGTCAACGAAACGCTGGTCGTCGTCGTCGGCGACCACGGACTATCGATCGCG
GAGCAGGGAAGCGTCTCGACGTATGCCAACGGTAATATCGGCAATTTCCACGTACCCTTCGTCATCTCACATCCC
GGGATGCCGCCGATCGACGTTAACGACACGGTTAACTCGATCCAGGTGCTGCCGACGATCCTCGACCTCCTGGCC
GAAACCGGCTCTTTGTCGGCAGCCGGGACGGAGGCCGCCCGAGATCTGGCCCGGAACTACGAGGGCCAGTCGCTC
ATCCGGCCGCAGCGCAATAGTTCCGGCCCCAAAGCTCGGCAAGTAGGGAACTGGCAATTCACCCTGATCAACCCC
GGCGGCTCCATGATCTCCGTACGCGACGCTCGACGCCCGACCTGGCGCCTGGTCGTCCCGATTGTCGAAAACACC
GAGTGGCGCTTCACCGATACTAAGTCGAATCCCCAGGAAGCCATCGCTCTTGTCTCCTTCGACTTTAAGTCGTTC
CTGCGCAGCATCCAAGACAGACACAGCACGAAGGCTTCGAGCTGGGCTGAGGAAGCCGCTTTCGTGACACGCTGG
CTGGTCGAGGAAAATGCGAGGCGTTGGCATTACAAGCAAAATTCAGTCACCAACACATAG
Transcript >Hirsu2|10431
ATGTACTCGCTCACCAGCCCCGTCTCGTCGGCTCGCTTCTTCAGCCGGCGCCTGGGCCTGGCTGCCGTCTCGCGG
TTCGGCGACCGCCGGTTCGCGTATGCCGTCGCCGCTGCCGCTGTCCTCGCCGCCAAGTTCCTACACGTCTACGCC
CATCTGGAAGCGCTGCCGGAGTACTATCTGACGCGATGGGGGCCTTCTTTCTTCACCCAGGACACCGTCTTCCTG
CTCGGCTTGCGCCTGATCATGGATGTGCGGCCGTCGATAACGAAAGGCTGGCTTCGGGCCGTCACAAAGCTCGTC
GTCTCGACTCTCGTCGCCTTCGTCACCCTCTTGGCCACCATCAGCATCTCTTTCTTCATGGTCGCCGGCCTGGAG
CTTCACTGGCGCAACATCGGCACCGCCGGCGACTCGTCGGCCTGGCGAATGCTCCTGACGGGGCTGGTCTCCTTC
GCCGTCGTCCTGGTCGGCATAATTTTGATCGCAAGCGTACTGCAGAACCTCTGCTACCTCATCGCCGGCATTGCA
CTCGATATTGTCCGCTGGCCGGTCTCGGCCCTGCTGAGTGCGCTCCCCGTACGGATATCCACGACCTCTCACCAT
CCCGAGTATCGGCACGTCCCGCAGCAGGACGCCGATGTAGCCGTCGAGCACGGACTCAAGTCGGCTGAGGACTGC
CCCGACATCGACGTCTCGGAGGCGCTTCCGATGCCGATGCCGTCCAAGATGGTCATGGTCGTGCTATATATTGGC
GTCTGCCTTGGACTCGTTGCCCAGCTCGCCACGGGCCTGTTGCGGCCCTCGGACGCTTCGCTGGTCTTCATGTCC
TGGACTGTGGCATTGTTGCCCTTTGTAGACTTCTCTCACTCCTCGCCATCGCTCGACCGGATACTCTCGGCCCCC
AGTGCCGAGGCCGACGCCAGCGCAGCGTCGTGGCAGAGGCAGAACCGCACCGCCCTTGCCGAGCCTCCCTCCTTC
CGCTGGCTCCCAAACGAAACGAAACTCGCTGGCTTCGAGGACTGGTATGGGCCAGACCAAAAGCACTACAGCGCG
GCCGACGACCCGCTCAAAATCTCCAACCTCGACGATGCTGTTCTCTCGGGCCTCGATGGCTCGCTCGACGATATC
AAGATCCGGCATGTCGTGCTAATCAAGCTCGAGGCCACCCGTAAGGACGTCTTTCCTATAAAGAAGGGCGGCTTC
ATATGGGAGCGCCTGGCGGGCTCATTCAAACACGAGCCGATGCCGGTCGAGGCGCAGGAGAGGCTGGCCACACTG
ACGGCAACCGCCAACTTTTTGACGGGCGACTACGACGACGGCTTCAAGCACCCAGAAAGGCCGCGCCGGGGTGGC
ATCAATTTTAACAACGGGCACTCGACCAGCACCTACACGTTGAAAAGTCTGGTTGGCACGCTATGCGGTTTGACG
CCCCTTATTGCTGACTTCAACCTCGAGGTTAACCACCACGTCTATCAGCCATGCCTGCCTCACGTCTTCGGAGCA
TTAAACCAGCTCAGGCACAGCGGAGACGGCAGCTCGAGTGACGATTTCACGACTTTCCAGTGGAAGCCGACCTTT
TTGCAGTCCGTCACGAGCTCGTTTGATAAGCAGACCGGCTTAATGGGAAAGCTGGGGTTTCTCGCCGATGATTTC
ATCACCAAGGAGTCCCTAAGGATCGGTTCTCCCAAGTTCGACCGCGTCACAGTCCCCGATATCAACTACTTCGGC
ATGCCCGAAACTACACTCGAGAACCATATTCGCGATGCCTTCTCGTCGGCTCAGCAAAACAAGGAACGCGTCTTC
CTCACCCACCTTACAAGCACGACGCACCACGCCTTTGGCCTCCCAGAAGGCGAAAAGTACGTGCCTCTCAACGAC
GAGAAGGATCTAGACGACTTATCGCATTACGTCAACGCCGTTGGTTTCGTCGACCGTTGGCTGGGCCGCGTGCTC
GACATCCTTGACGCTGAGGGCGTCGTCAACGAAACGCTGGTCGTCGTCGTCGGCGACCACGGACTATCGATCGCG
GAGCAGGGAAGCGTCTCGACGTATGCCAACGGTAATATCGGCAATTTCCACGTACCCTTCGTCATCTCACATCCC
GGGATGCCGCCGATCGACGTTAACGACACGGTTAACTCGATCCAGGTGCTGCCGACGATCCTCGACCTCCTGGCC
GAAACCGGCTCTTTGTCGGCAGCCGGGACGGAGGCCGCCCGAGATCTGGCCCGGAACTACGAGGGCCAGTCGCTC
ATCCGGCCGCAGCGCAATAGTTCCGGCCCCAAAGCTCGGCAAGTAGGGAACTGGCAATTCACCCTGATCAACCCC
GGCGGCTCCATGATCTCCGTACGCGACGCTCGACGCCCGACCTGGCGCCTGGTCGTCCCGATTGTCGAAAACACC
GAGTGGCGCTTCACCGATACTAAGTCGAATCCCCAGGAAGCCATCGCTCTTGTCTCCTTCGACTTTAAGTCGTTC
CTGCGCAGCATCCAAGACAGACACAGCACGAAGGCTTCGAGCTGGGCTGAGGAAGCCGCTTTCGTGACACGCTGG
CTGGTCGAGGAAAATGCGAGGCGTTGGCATTACAAGCAAAATTCAGTCACCAACACATAG
Gene >Hirsu2|10431
ATGTACTCGCTCACCAGCCCCGTCTCGTCGGCTCGCTTCTTCAGCCGGCGCCTGGGCCTGGCTGCCGTCTCGCGG
TTCGGCGACCGCCGGTTCGCGTATGCCGTCGCCGCTGCCGCTGTCCTCGCCGCCAAGTTCCTACACGTCTACGCC
CATCTGGAAGCGCTGCCGGAGTACTATCTGACGCGATGGGGGCCTTCTTTCTTCACCCAGGACACCGTCTTCCTG
CTCGGCTTGCGCCTGATCATGGATGTGCGGCCGTCGATAACGAAAGGCTGGCTTCGGGCCGTCACAAAGCTCGTC
GTCTCGACTCTCGTCGCCTTCGTCACCCTCTTGGCCACCATCAGCATCTCTTTCTTCATGGTCGCCGGCCTGGAG
CTTCACTGGCGCAACATCGGCACCGCCGGCGACTCGTCGGCCTGGCGAATGCTCCTGACGGGGCTGGTCTCCTTC
GCCGTCGTCCTGGTCGGCATAATTTTGATCGCAAGCGTACTGCAGAACCTCTGCTACCTCATCGCCGGCATTGCA
CTCGATATTGTCCGCTGGCCGGTCTCGGCCCTGCTGAGTGCGCTCCCCGTACGGATATCCACGACCTCTCACCAT
CCCGAGTATCGGCACGTCCCGCAGCAGGACGCCGATGTAGCCGTCGAGCACGGACTCAAGTCGGCTGAGGACTGC
CCCGACATCGACGTCTCGGAGGCGCTTCCGATGCCGATGCCGTCCAAGATGGTCATGGTCGTGCTATATATTGGC
GTCTGCCTTGGACTCGTTGCCCAGCTCGCCACGGGCCTGTTGCGGCCCTCGGACGCTTCGCTGGTCTTCATGTCC
TGGACTGTGGCATTGTTGCCCTTTGTAGACTTCTCTCACTCCTCGCCATCGCTCGACCGGATACTCTCGGCCCCC
AGTGCCGAGGCCGACGCCAGCGCAGCGTCGTGGCAGAGGCAGAACCGCACCGCCCTTGCCGAGCCTCCCTCCTTC
CGCTGGCTCCCAAACGAAACGAAACTCGCTGGCTTCGAGGACTGGTATGGGCCAGACCAAAAGCACTACAGCGCG
GCCGACGACCCGCTCAAAATCTCCAACCTCGACGATGCTGTTCTCTCGGGCCTCGATGGCTCGCTCGACGATATC
AAGATCCGGCATGTCGTGCTAATCAAGCTCGAGGCCACCCGTAAGGACGTCTTTCCTATAAAGAAGGGCGGCTTC
ATATGGGAGCGCCTGGCGGGCTCATTCAAACACGAGCCGATGCCGGTCGAGGCGCAGGAGAGGCTGGCCACACTG
ACGGCAACCGCCAACTTTTTGACGGGCGACTACGACGACGGCTTCAAGCACCCAGAAAGGCCGCGCCGGGGTGGC
ATCAATTTTAACAACGGGCACTCGACCAGCACCTACACGTTGAAAAGTCTGGTTGGCACGCTATGCGGTTTGACG
CCCCTTATTGCTGACTTCAACCTCGAGGTTAACCACCACGTCTATCAGCCATGCCTGCCTCACGTCTTCGGAGCA
TTAAACCAGCTCAGGCACAGCGGAGACGGCAGCTCGAGTGACGATTTCACGACTTTCCAGTGGAAGCCGACCTTT
TTGCAGTCCGTCACGAGCTCGTTTGATAAGCAGACCGGCTTAATGGGAAAGCTGGGGTTTCTCGCCGATGATTTC
ATCACCAAGGAGTCCCTAAGGATCGGTTCTCCCAAGTTCGACCGCGTCACAGTCCCCGATATCAACTACTTCGGC
ATGCCCGAAACTACACTCGAGAACCATATTCGCGATGCCTTCTCGTCGGCTCAGCAAAACAAGGAACGCGTCTTC
CTCACCCACCTTACAAGCACGACGCACCACGCCTTTGGCCTCCCAGAAGGCGAAAAGTACGTGCCTCTCAACGAC
GAGAAGGATCTAGACGACTTATCGCATTACGTCAACGCCGTTGGTTTCGTCGACCGTTGGCTGGGCCGCGTGCTC
GACATCCTTGACGCTGAGGGCGTCGTCAACGAAACGCTGGTCGTCGTCGTCGGCGACCACGGACTATCGATCGCG
GAGCAGGGAAGCGTCTCGACGTATGCCAACGGTAATATCGGCAATTTCCACGTACCCTTCGTCATCTCACATCCC
GGGATGCCGCCGATCGACGTTAACGACACGGTTAACTCGATCCAGGTGCTGCCGACGATCCTCGACCTCCTGGCC
GAAACCGGCTCTTTGTCGGCAGCCGGGACGGAGGCCGCCCGAGATCTGGCCCGGAACTACGAGGGCCAGTCGCTC
ATCCGGCCGCAGCGCAATAGTTCCGGCCCCAAAGCTCGGCAAGTAGGGAACTGGCAATTCACCCTGATCAACCCC
GGCGGCTCCATGATCTCCGTACGCGACGCTCGACGCCCGACCTGGCGCCTGGTCGTCCCGATTGTCGAAAACACC
GAGTGGCGCTTCACCGATACTAAGTCGAATCCCCAGGAAGCCATCGCTCTTGTCTCCTTCGACTTTAAGTCGTTC
CTGCGCAGCATCCAAGACAGACACAGCACGAAGGCTTCGAGCTGGGCTGAGGAAGCCGCTTTCGTGACACGCTGG
CTGGTCGAGGAAAATGCGAGGCGTTGGCATTACAAGCAAAATTCAGTCACCAACACATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail