Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10424
Gene name
LocationContig_84:26663..31665
Strand-
Gene length (bp)5002
Transcript length (bp)4617
Coding sequence length (bp)4617
Protein length (aa) 1539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 6.3E-40 524 733
PF01061 ABC2_membrane ABC-2 type transporter 3.0E-41 1189 1398
PF00005 ABC_tran ABC transporter 3.5E-16 203 356
PF00005 ABC_tran ABC transporter 4.1E-18 888 1039
PF06422 PDR_CDR CDR ABC transporter 7.0E-28 745 831
PF14510 ABC_trans_N ABC-transporter N-terminal 4.0E-16 83 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 115 1499 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 1 1495 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 119 1504 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 119 1504 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 119 1499 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 115 1499 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 1 1495 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 119 1504 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 119 1504 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 119 1499 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 109 1499 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 125 1498 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 51 1509 0.0E+00
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 73 1517 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 189 1473 0.0E+00
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 120 1494 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 114 1494 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 114 1494 0.0E+00
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 116 1492 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 120 1494 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 123 1494 0.0E+00
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 113 1492 0.0E+00
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 111 1494 0.0E+00
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 113 1498 0.0E+00
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 191 1498 0.0E+00
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 162 1496 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 110 1499 0.0E+00
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 92 1495 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 115 1499 0.0E+00
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 189 1492 1.0E-144
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 62 1398 3.0E-144
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 130 1421 6.0E-143
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 62 1398 1.0E-141
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 195 1413 3.0E-141
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 134 1398 3.0E-141
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 130 1411 5.0E-141
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 130 1401 1.0E-139
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 18 1399 5.0E-139
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 130 1398 9.0E-139
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 131 1415 1.0E-137
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 130 1401 4.0E-137
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 195 1398 5.0E-137
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 127 1413 5.0E-136
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 185 1398 9.0E-136
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 190 1415 1.0E-135
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 133 1398 3.0E-135
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 134 1399 6.0E-135
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 194 1399 2.0E-134
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 132 1398 5.0E-134
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 7 1413 5.0E-134
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 122 1430 6.0E-134
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 189 1399 7.0E-134
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 187 1413 1.0E-133
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 23 1402 6.0E-132
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 130 1413 6.0E-131
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 129 1399 6.0E-131
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 189 1403 4.0E-129
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 194 1421 7.0E-129
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 189 1399 3.0E-128
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 189 1409 3.0E-128
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 189 1399 3.0E-128
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 129 1415 7.0E-128
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 130 1399 1.0E-127
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 124 1416 4.0E-126
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 189 1399 1.0E-125
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 68 1399 2.0E-125
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 190 1128 2.0E-125
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 189 1429 1.0E-124
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 189 1413 3.0E-124
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 28 1399 5.0E-123
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 143 1399 6.0E-122
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 130 1430 7.0E-122
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 120 1408 4.0E-118
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 189 1169 5.0E-118
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 130 1415 6.0E-114
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 194 1413 4.0E-110
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 881 1413 4.0E-71
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 881 1416 4.0E-70
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 853 1499 5.0E-58
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 189 806 3.0E-57
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 865 1391 5.0E-57
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 868 1391 5.0E-56
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 188 806 1.0E-55
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 868 1391 4.0E-55
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 868 1499 7.0E-55
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 805 1411 4.0E-54
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 868 1368 1.0E-53
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 887 1422 3.0E-53
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 887 1499 7.0E-53
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 884 1411 1.0E-52
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 850 1492 1.0E-52
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 870 1406 2.0E-52
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 842 1491 3.0E-52
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 884 1398 1.0E-51
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 887 1418 5.0E-51
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 883 1415 5.0E-50
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 193 806 8.0E-50
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 867 1415 9.0E-50
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 193 806 1.0E-49
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 887 1406 3.0E-49
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 193 734 4.0E-49
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 872 1492 2.0E-48
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 879 1494 4.0E-48
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 865 1378 7.0E-48
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 193 738 8.0E-48
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 879 1499 9.0E-48
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 185 738 1.0E-47
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 881 1306 1.0E-47
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 193 734 2.0E-47
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 152 738 3.0E-47
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 869 1130 3.0E-47
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 885 1415 8.0E-47
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 885 1415 9.0E-47
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 869 1417 1.0E-46
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 869 1420 1.0E-46
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 862 1491 2.0E-46
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 188 738 3.0E-46
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 887 1409 5.0E-46
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 187 742 6.0E-46
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 872 1492 3.0E-45
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 869 1307 4.0E-45
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 869 1307 4.0E-45
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 189 741 6.0E-45
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 883 1411 7.0E-45
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 864 1391 9.0E-45
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 836 1385 2.0E-44
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 864 1536 5.0E-44
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 883 1389 1.0E-43
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 879 1398 2.0E-43
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 871 1401 2.0E-43
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 888 1379 3.0E-43
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 884 1406 3.0E-43
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 873 1135 4.0E-42
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 883 1401 9.0E-42
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 190 738 2.0E-41
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 849 1389 3.0E-41
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 187 738 6.0E-41
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 871 1297 6.0E-41
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 885 1313 9.0E-41
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 878 1129 1.0E-40
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 871 1420 1.0E-40
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 885 1147 1.0E-40
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 807 1420 3.0E-40
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 878 1140 5.0E-40
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 871 1303 7.0E-40
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 881 1389 3.0E-39
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 186 825 5.0E-39
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 886 1502 2.0E-38
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 205 756 2.0E-38
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 191 800 5.0E-38
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 189 746 2.0E-37
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 76 741 2.0E-37
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 205 739 4.0E-37
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 885 1308 4.0E-37
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 193 733 5.0E-37
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 188 814 3.0E-36
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 880 1149 3.0E-36
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 839 1319 1.0E-35
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 195 806 3.0E-35
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 143 742 3.0E-35
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 890 1357 9.0E-35
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 890 1357 1.0E-34
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 193 825 2.0E-34
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 205 738 2.0E-34
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 883 1130 3.0E-34
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 878 1129 4.0E-34
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 885 1417 5.0E-34
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 195 741 6.0E-34
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 191 742 6.0E-34
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 888 1403 6.0E-34
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 869 1128 7.0E-34
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 886 1399 1.0E-33
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 185 733 1.0E-33
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 885 1417 2.0E-33
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 148 779 3.0E-33
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 189 733 3.0E-33
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 113 733 7.0E-33
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 190 733 1.0E-32
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 885 1436 1.0E-32
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 195 740 2.0E-32
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 113 800 2.0E-32
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 186 738 5.0E-32
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 193 821 1.0E-31
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 192 806 1.0E-31
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 189 729 2.0E-31
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 195 746 3.0E-31
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 186 738 1.0E-30
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 887 1359 1.0E-30
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 193 742 2.0E-30
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 887 1398 2.0E-30
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 193 751 6.0E-30
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 194 745 7.0E-30
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 850 1451 8.0E-30
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 189 729 1.0E-29
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 194 797 2.0E-29
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 194 797 3.0E-29
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 191 734 3.0E-29
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 883 1142 6.0E-29
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 195 732 8.0E-29
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 175 807 1.0E-28
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 189 751 2.0E-28
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 193 740 3.0E-28
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 887 1400 5.0E-28
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 185 733 6.0E-28
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 881 1400 2.0E-27
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 193 742 2.0E-27
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 881 1413 4.0E-27
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 174 740 4.0E-27
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 193 733 9.0E-27
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 193 733 1.0E-26
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 190 738 1.0E-26
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 188 733 3.0E-26
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 193 733 6.0E-26
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 887 1407 7.0E-26
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 193 733 8.0E-26
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 195 814 8.0E-26
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 194 445 1.0E-25
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 190 804 2.0E-25
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 175 793 4.0E-25
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 191 734 9.0E-25
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 885 1366 2.0E-24
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 881 1497 5.0E-24
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 887 1399 5.0E-24
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 181 737 6.0E-24
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 881 1407 9.0E-24
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 181 720 1.0E-23
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 181 737 7.0E-23
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 881 1413 1.0E-22
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 887 1413 2.0E-22
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 191 761 5.0E-22
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 881 1405 2.0E-21
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 881 1405 2.0E-21
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 873 1405 6.0E-21
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 189 807 1.0E-20
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 168 738 3.0E-20
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 887 1403 5.0E-20
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 189 675 6.0E-19
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 190 733 7.0E-19
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 881 1057 2.0E-18
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 886 1132 3.0E-18
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 887 1057 1.0E-17
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 193 464 3.0E-17
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 193 424 3.0E-17
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 193 442 3.0E-17
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 191 737 1.0E-16
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 886 1068 1.0E-16
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 888 1087 2.0E-14
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 888 1087 2.0E-14
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 888 1087 2.0E-14
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 885 1087 9.0E-14
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 885 1087 2.0E-13
sp|Q6HI76|Y2424_BACHK Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1 888 1087 4.0E-13
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 888 1087 4.0E-13
sp|Q6YRJ4|Y020_ONYPE Putative ABC transporter ATP-binding protein PAM_020 OS=Onion yellows phytoplasma (strain OY-M) GN=PAM_020 PE=3 SV=1 863 1087 5.0E-13
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 188 442 5.0E-13
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 887 1087 6.0E-13
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 887 1087 6.0E-13
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 652 1087 8.0E-13
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 884 1088 1.0E-12
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 887 1087 1.0E-12
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 875 1069 1.0E-12
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 885 1087 2.0E-12
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 884 1088 3.0E-12
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 887 1087 3.0E-12
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 887 1087 3.0E-12
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 887 1087 3.0E-12
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 823 1068 3.0E-12
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 887 1087 3.0E-12
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 887 1087 3.0E-12
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 887 1087 3.0E-12
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 887 1087 3.0E-12
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 887 1087 3.0E-12
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 888 1087 5.0E-12
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 775 1068 5.0E-12
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 849 1087 6.0E-12
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 885 1094 1.0E-11
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 840 1068 1.0E-11
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 872 1087 1.0E-11
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 887 1087 1.0E-11
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 619 1087 1.0E-11
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 887 1087 1.0E-11
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 887 1087 2.0E-11
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 887 1087 2.0E-11
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 855 1068 2.0E-11
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 888 1058 3.0E-11
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 833 1087 3.0E-11
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 887 1068 4.0E-11
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 193 441 4.0E-11
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 878 1068 5.0E-11
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 884 1087 5.0E-11
sp|Q82G23|PSTB_STRAW Phosphate import ATP-binding protein PstB OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pstB PE=3 SV=1 886 1066 5.0E-11
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 867 1094 5.0E-11
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 887 1068 6.0E-11
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 887 1087 6.0E-11
sp|Q0BFU0|RBSA1_BURCM Ribose import ATP-binding protein RbsA 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rbsA1 PE=3 SV=1 886 1087 6.0E-11
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 896 1098 7.0E-11
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 883 1098 7.0E-11
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 886 1087 7.0E-11
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 544 768 8.0E-11
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 887 1087 9.0E-11
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 530 741 9.0E-11
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 887 1088 1.0E-10
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 888 1096 1.0E-10
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 888 1089 1.0E-10
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 898 1087 1.0E-10
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 888 1087 1.0E-10
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 888 1087 2.0E-10
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 888 1056 2.0E-10
sp|Q6ADG4|PSTB_LEIXX Phosphate import ATP-binding protein PstB OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pstB PE=3 SV=1 888 1066 2.0E-10
sp|Q87UN0|ZNUC_PSESM Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=znuC PE=3 SV=1 878 1086 2.0E-10
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 886 1087 2.0E-10
sp|Q2LY16|CBIO_SYNAS Cobalt import ATP-binding protein CbiO OS=Syntrophus aciditrophicus (strain SB) GN=cbiO PE=3 SV=1 883 1091 2.0E-10
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 895 1087 3.0E-10
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 888 1085 3.0E-10
sp|Q48PV0|ZNUC_PSE14 Zinc import ATP-binding protein ZnuC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=znuC PE=3 SV=1 878 1086 3.0E-10
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 885 1111 4.0E-10
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 887 1087 4.0E-10
sp|A0B3Z7|ARAG2_BURCH Arabinose import ATP-binding protein AraG 2 OS=Burkholderia cenocepacia (strain HI2424) GN=araG2 PE=3 SV=1 886 1104 4.0E-10
sp|Q1BJW2|ARAG2_BURCA Arabinose import ATP-binding protein AraG 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=araG2 PE=3 SV=1 886 1104 4.0E-10
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 888 1087 4.0E-10
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 887 1087 5.0E-10
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 888 1068 5.0E-10
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 885 1087 5.0E-10
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 877 1087 5.0E-10
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 888 1087 5.0E-10
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 868 1098 6.0E-10
sp|Q39GY8|RBSA1_BURL3 Ribose import ATP-binding protein RbsA 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rbsA1 PE=3 SV=1 886 1096 6.0E-10
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 886 1087 7.0E-10
sp|P42360|YSC1_STRGN Uncharacterized ABC transporter ATP-binding protein in scaA 5'region OS=Streptococcus gordonii PE=3 SV=1 874 1095 7.0E-10
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 886 1110 7.0E-10
sp|Q9CL63|RBSA2_PASMU Ribose import ATP-binding protein RbsA 2 OS=Pasteurella multocida (strain Pm70) GN=rbsA2 PE=3 SV=1 857 1151 8.0E-10
sp|Q8G7F4|PSTB_BIFLO Phosphate import ATP-binding protein PstB OS=Bifidobacterium longum (strain NCC 2705) GN=pstB PE=3 SV=1 888 1095 8.0E-10
sp|Q9WXX0|RBSA1_THEMA Ribose import ATP-binding protein RbsA 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbsA1 PE=3 SV=1 888 1136 9.0E-10
sp|Q4ZZS2|ZNUC_PSEU2 Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=znuC PE=3 SV=1 878 1086 9.0E-10
sp|Q4UMZ7|LOLD_RICFE Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lolD PE=3 SV=1 886 1087 9.0E-10
sp|Q1JUP7|ARAG_AZOBR Arabinose import ATP-binding protein AraG OS=Azospirillum brasilense GN=araG PE=3 SV=1 886 1104 1.0E-09
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 887 1087 1.0E-09
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 888 1068 1.0E-09
sp|Q39BJ8|ARAG2_BURL3 Arabinose import ATP-binding protein AraG 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=araG2 PE=3 SV=1 886 1104 1.0E-09
sp|Q32HA3|ZNUC_SHIDS Zinc import ATP-binding protein ZnuC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=znuC PE=3 SV=1 885 1056 1.0E-09
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 888 1087 1.0E-09
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 887 1089 1.0E-09
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 878 1068 1.0E-09
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 878 1068 1.0E-09
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 878 1068 1.0E-09
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 878 1094 1.0E-09
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 878 1094 1.0E-09
sp|Q8YK28|PHNC3_NOSS1 Phosphonates import ATP-binding protein PhnC 3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=phnC3 PE=3 SV=1 888 1098 1.0E-09
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 868 1094 1.0E-09
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 885 1103 1.0E-09
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 887 1087 1.0E-09
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 193 411 1.0E-09
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 195 451 1.0E-09
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 195 375 1.0E-09
sp|Q3Z2L6|ZNUC_SHISS Zinc import ATP-binding protein ZnuC OS=Shigella sonnei (strain Ss046) GN=znuC PE=3 SV=1 885 1056 2.0E-09
sp|Q322E8|ZNUC_SHIBS Zinc import ATP-binding protein ZnuC OS=Shigella boydii serotype 4 (strain Sb227) GN=znuC PE=3 SV=1 885 1056 2.0E-09
sp|Q1RAS6|ZNUC_ECOUT Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain UTI89 / UPEC) GN=znuC PE=3 SV=1 885 1056 2.0E-09
sp|P0A9X1|ZNUC_ECOLI Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain K12) GN=znuC PE=1 SV=1 885 1056 2.0E-09
sp|P0A9X2|ZNUC_ECOL6 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=znuC PE=3 SV=1 885 1056 2.0E-09
sp|Q0TGX4|ZNUC_ECOL5 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=znuC PE=3 SV=1 885 1056 2.0E-09
sp|A1AC19|ZNUC_ECOK1 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O1:K1 / APEC GN=znuC PE=3 SV=1 885 1056 2.0E-09
sp|P0A9X3|ZNUC_ECO57 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O157:H7 GN=znuC PE=3 SV=1 885 1056 2.0E-09
sp|Q82HA2|Y3608_STRAW Putative ABC transporter ATP-binding protein SAV_3608 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_3608 PE=3 SV=1 895 1056 2.0E-09
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 881 1098 2.0E-09
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 888 1087 2.0E-09
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 878 1087 2.0E-09
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 878 1087 2.0E-09
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 885 1087 2.0E-09
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 887 1087 2.0E-09
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 878 1087 2.0E-09
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 896 1087 2.0E-09
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 881 1091 2.0E-09
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 881 1091 2.0E-09
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 888 1087 2.0E-09
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 885 1069 2.0E-09
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 885 1069 2.0E-09
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 885 1069 2.0E-09
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 885 1069 2.0E-09
sp|Q92GP5|LOLD_RICCN Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lolD PE=3 SV=1 886 1068 2.0E-09
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 877 1073 2.0E-09
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 189 375 2.0E-09
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 900 1069 3.0E-09
sp|A0K718|RBSA1_BURCH Ribose import ATP-binding protein RbsA 1 OS=Burkholderia cenocepacia (strain HI2424) GN=rbsA1 PE=3 SV=1 886 1096 3.0E-09
sp|Q1BWN5|RBSA1_BURCA Ribose import ATP-binding protein RbsA 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=rbsA1 PE=3 SV=1 886 1096 3.0E-09
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 865 1068 3.0E-09
sp|Q2T8T6|RBSA2_BURTA Ribose import ATP-binding protein RbsA 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rbsA2 PE=3 SV=1 886 1100 3.0E-09
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 877 1068 3.0E-09
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 888 1134 3.0E-09
sp|Q0BZD8|PHNC_HYPNA Phosphonates import ATP-binding protein PhnC OS=Hyphomonas neptunium (strain ATCC 15444) GN=phnC PE=3 SV=1 895 1092 3.0E-09
sp|Q8X5Q4|RBSA2_ECO57 Ribose import ATP-binding protein RbsA 2 OS=Escherichia coli O157:H7 GN=rbsA2 PE=3 SV=3 888 1087 3.0E-09
sp|Q9EUS2|PSTB_STRGR Phosphate import ATP-binding protein PstB OS=Streptomyces griseus GN=pstB PE=3 SV=1 886 1089 3.0E-09
sp|A1JRI2|ZNUC_YERE8 Zinc import ATP-binding protein ZnuC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=znuC PE=3 SV=1 878 1084 3.0E-09
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 888 1087 3.0E-09
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 881 1085 4.0E-09
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 878 1084 4.0E-09
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 878 1084 4.0E-09
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 878 1084 4.0E-09
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 878 1084 4.0E-09
sp|Q6VMN4|XYLG_THEP3 Xylose import ATP-binding protein XylG OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=xylG PE=3 SV=1 886 1135 4.0E-09
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 895 1094 4.0E-09
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 888 1087 4.0E-09
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 886 1056 4.0E-09
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 886 1098 4.0E-09
sp|Q2K0S7|RBSA3_RHIEC Ribose import ATP-binding protein RbsA 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rbsA3 PE=3 SV=1 886 1096 4.0E-09
sp|Q9X1Z1|ECFA1_THEMA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA1 PE=1 SV=1 887 1087 4.0E-09
sp|Q3JHZ1|RBSA2_BURP1 Ribose import ATP-binding protein RbsA 2 OS=Burkholderia pseudomallei (strain 1710b) GN=rbsA2 PE=3 SV=1 886 1096 4.0E-09
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 850 1095 5.0E-09
sp|Q035B3|ECFA2_LACC3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus casei (strain ATCC 334) GN=ecfA2 PE=1 SV=1 888 1069 5.0E-09
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 872 1087 5.0E-09
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 881 1054 5.0E-09
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 888 1087 5.0E-09
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 888 1087 5.0E-09
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 888 1087 5.0E-09
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 900 1069 5.0E-09
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 897 1098 6.0E-09
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 867 1098 6.0E-09
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 888 1086 6.0E-09
sp|Q9X051|RBSA2_THEMA Ribose import ATP-binding protein RbsA 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbsA2 PE=3 SV=1 883 1093 6.0E-09
sp|Q9K789|METN_BACHD Methionine import ATP-binding protein MetN OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metN PE=3 SV=1 888 1132 7.0E-09
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 895 1094 7.0E-09
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 888 1087 7.0E-09
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 888 1087 7.0E-09
sp|Q63P06|RBSA_BURPS Ribose import ATP-binding protein RbsA OS=Burkholderia pseudomallei (strain K96243) GN=rbsA PE=3 SV=1 886 1096 7.0E-09
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 881 1098 7.0E-09
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 883 1069 8.0E-09
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 888 1068 8.0E-09
sp|Q83KR7|ZNUC_SHIFL Zinc import ATP-binding protein ZnuC OS=Shigella flexneri GN=znuC PE=3 SV=1 885 1056 8.0E-09
sp|Q0T3U8|ZNUC_SHIF8 Zinc import ATP-binding protein ZnuC OS=Shigella flexneri serotype 5b (strain 8401) GN=znuC PE=3 SV=1 885 1056 8.0E-09
sp|O34814|FTSE_BACSU Cell division ATP-binding protein FtsE OS=Bacillus subtilis (strain 168) GN=ftsE PE=1 SV=1 886 1073 8.0E-09
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 881 1098 8.0E-09
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 881 1101 8.0E-09
sp|Q2NHA1|ECFA_METST Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ecfA PE=3 SV=1 895 1079 8.0E-09
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 886 1087 8.0E-09
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 871 1098 9.0E-09
sp|Q9PHQ1|PSTB_CAMJE Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pstB PE=3 SV=1 882 1066 9.0E-09
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 887 1087 9.0E-09
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 887 1068 9.0E-09
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 835 1087 1.0E-08
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 886 1087 1.0E-08
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 859 1073 1.0E-08
sp|P45769|YHDZ_ECOLI Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ OS=Escherichia coli (strain K12) GN=yhdZ PE=3 SV=1 887 1087 1.0E-08
sp|Q81HW8|RBSA_BACCR Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbsA PE=3 SV=1 873 1087 1.0E-08
sp|Q8RQL7|GLUA_COREF Glutamate transport ATP-binding protein GluA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gluA PE=3 SV=1 888 1088 1.0E-08
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 850 1088 1.0E-08
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 879 1089 1.0E-08
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 888 1068 1.0E-08
sp|Q3MB44|RBSA_ANAVT Ribose import ATP-binding protein RbsA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rbsA PE=3 SV=1 878 1160 1.0E-08
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 888 1098 1.0E-08
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 887 1087 1.0E-08
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 885 1139 1.0E-08
sp|Q2RZ08|HMUV_SALRD Hemin import ATP-binding protein HmuV OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hmuV PE=3 SV=1 875 1088 1.0E-08
sp|Q9JZW0|CYSA_NEIMB Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysA PE=3 SV=1 888 1073 1.0E-08
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 203 415 2.0E-08
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 203 415 2.0E-08
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 895 1073 2.0E-08
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 877 1068 2.0E-08
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 856 1068 2.0E-08
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 895 1087 2.0E-08
sp|Q9KXJ6|Y2324_STRCO Putative ABC transporter ATP-binding protein SCO2324 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2324 PE=3 SV=1 888 1087 2.0E-08
sp|Q98KI3|MODC_RHILO Molybdenum import ATP-binding protein ModC OS=Rhizobium loti (strain MAFF303099) GN=modC PE=3 SV=1 898 1087 2.0E-08
sp|Q12R52|HMUV_SHEDO Hemin import ATP-binding protein HmuV OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=hmuV PE=3 SV=1 887 1068 2.0E-08
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 886 1058 2.0E-08
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 888 1068 2.0E-08
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 888 1087 2.0E-08
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 887 1095 2.0E-08
sp|Q1M5X4|RBSA2_RHIL3 Ribose import ATP-binding protein RbsA 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rbsA2 PE=3 SV=1 886 1096 2.0E-08
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 868 1056 2.0E-08
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 868 1056 2.0E-08
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 796 1087 2.0E-08
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 883 1087 2.0E-08
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 886 1087 2.0E-08
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 881 1096 2.0E-08
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 886 1087 2.0E-08
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 888 1110 2.0E-08
sp|Q9JUX4|CYSA_NEIMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysA PE=3 SV=1 888 1073 2.0E-08
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 886 1087 2.0E-08
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 871 1095 2.0E-08
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 886 1087 2.0E-08
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 865 1068 3.0E-08
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 888 1087 3.0E-08
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 876 1087 3.0E-08
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 842 1068 3.0E-08
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 869 1087 3.0E-08
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 877 1101 3.0E-08
sp|Q5HVF4|PSTB_CAMJR Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni (strain RM1221) GN=pstB PE=3 SV=1 882 1066 3.0E-08
sp|Q8Y651|MNTB_LISMO Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1 878 1086 3.0E-08
sp|Q9CIS8|ECFA2_LACLA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ecfA2 PE=3 SV=1 886 1110 4.0E-08
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 888 1068 4.0E-08
sp|Q0SZJ3|NIKE_SHIF8 Nickel import ATP-binding protein NikE OS=Shigella flexneri serotype 5b (strain 8401) GN=nikE PE=3 SV=1 881 1098 4.0E-08
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 888 1073 4.0E-08
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 887 1087 4.0E-08
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 887 1091 4.0E-08
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 887 1091 4.0E-08
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 898 1087 4.0E-08
sp|Q74I62|Y1704_LACJO Putative ABC transporter ATP-binding protein LJ_1704 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=LJ_1704 PE=3 SV=1 881 1087 4.0E-08
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 824 1087 4.0E-08
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 888 1096 4.0E-08
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 881 1087 4.0E-08
sp|Q6G2E2|METN_BARHE Methionine import ATP-binding protein MetN OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=metN PE=3 SV=1 205 462 4.0E-08
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 882 1088 4.0E-08
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 877 1095 4.0E-08
sp|Q51719|YCOBA_PROFR Putative ABC transporter ATP-binding protein in cobA 5'region OS=Propionibacterium freudenreichii subsp. shermanii PE=3 SV=1 886 1068 4.0E-08
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 885 1087 4.0E-08
sp|Q83J77|NIKE_SHIFL Nickel import ATP-binding protein NikE OS=Shigella flexneri GN=nikE PE=3 SV=1 881 1098 4.0E-08
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 888 1073 4.0E-08
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 882 1067 5.0E-08
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 878 1087 5.0E-08
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 868 1056 5.0E-08
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 868 1056 5.0E-08
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 868 1056 5.0E-08
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 868 1056 5.0E-08
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 882 1089 5.0E-08
sp|Q92UI2|RBSA3_RHIME Ribose import ATP-binding protein RbsA 3 OS=Rhizobium meliloti (strain 1021) GN=rbsA3 PE=3 SV=1 888 1091 5.0E-08
sp|Q1WVI7|POTA_LACS1 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus salivarius (strain UCC118) GN=potA PE=3 SV=1 886 1094 5.0E-08
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 886 1042 5.0E-08
sp|A1URR2|UGPC_BARBK sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ugpC PE=3 SV=1 887 1142 5.0E-08
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 868 1056 5.0E-08
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 868 1056 5.0E-08
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 868 1056 5.0E-08
sp|D4GSY7|ANTRA_HALVD Probable anion import ATP-binding protein HVO_1886 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_1886 PE=3 SV=1 835 1069 5.0E-08
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 876 1094 5.0E-08
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 895 1087 5.0E-08
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 878 1096 5.0E-08
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 796 1087 5.0E-08
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 888 1087 5.0E-08
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 888 1073 5.0E-08
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 888 1054 5.0E-08
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 888 1095 5.0E-08
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 888 1095 5.0E-08
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 895 1087 5.0E-08
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 887 1087 5.0E-08
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 895 1095 6.0E-08
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 881 1054 6.0E-08
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 888 1058 6.0E-08
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 895 1087 6.0E-08
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 868 1056 6.0E-08
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 887 1056 6.0E-08
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 887 1056 6.0E-08
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 887 1056 6.0E-08
sp|Q04B25|METN_LACDB Methionine import ATP-binding protein MetN OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=metN PE=3 SV=1 888 1098 6.0E-08
sp|Q1GAN9|METN_LACDA Methionine import ATP-binding protein MetN OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=metN PE=3 SV=1 888 1098 6.0E-08
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 856 1068 6.0E-08
sp|O78474|ABCX_GUITH Probable ATP-dependent transporter ycf16 OS=Guillardia theta GN=ycf16 PE=3 SV=1 195 426 6.0E-08
sp|Q3KKA1|ZNUC_PSEPF Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf0-1) GN=znuC PE=3 SV=1 878 1086 6.0E-08
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 887 1089 6.0E-08
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 888 1087 7.0E-08
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 875 1094 7.0E-08
sp|Q8E3S6|Y1680_STRA3 Putative ABC transporter ATP-binding protein gbs1680 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1680 PE=3 SV=1 874 1087 7.0E-08
sp|P51241|ABCX_PORPU Probable ATP-dependent transporter ycf16 OS=Porphyra purpurea GN=ycf16 PE=3 SV=1 887 1111 7.0E-08
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 888 1098 7.0E-08
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 895 1095 7.0E-08
sp|Q92LX3|METN_RHIME Methionine import ATP-binding protein MetN OS=Rhizobium meliloti (strain 1021) GN=metN PE=3 SV=1 864 1069 7.0E-08
sp|Q31YV7|MGLA_SHIBS Galactose/methyl galactoside import ATP-binding protein MglA OS=Shigella boydii serotype 4 (strain Sb227) GN=mglA PE=3 SV=1 886 1130 7.0E-08
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 895 1095 8.0E-08
sp|Q65T42|CYSA_MANSM Sulfate/thiosulfate import ATP-binding protein CysA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysA PE=3 SV=1 888 1087 8.0E-08
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 871 1095 8.0E-08
sp|Q65E55|RBSA_BACLD Ribose import ATP-binding protein RbsA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rbsA PE=3 SV=1 878 1087 8.0E-08
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 868 1104 9.0E-08
sp|Q56953|YFEB_YERPE Chelated iron transport system membrane protein YfeB OS=Yersinia pestis GN=yfeB PE=3 SV=1 898 1073 9.0E-08
sp|Q2SJB5|MODC_HAHCH Molybdenum import ATP-binding protein ModC OS=Hahella chejuensis (strain KCTC 2396) GN=modC PE=3 SV=1 897 1056 9.0E-08
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 888 1098 9.0E-08
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 888 1056 9.0E-08
sp|Q89EW7|MODC2_BRADU Molybdenum import ATP-binding protein ModC 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=modC2 PE=3 SV=1 877 1087 9.0E-08
sp|Q8DY60|Y1633_STRA5 Putative ABC transporter ATP-binding protein SAG1633 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG1633 PE=3 SV=1 874 1087 9.0E-08
sp|Q0RYP7|FBPC3_RHOJR Fe(3+) ions import ATP-binding protein FbpC 3 OS=Rhodococcus jostii (strain RHA1) GN=fbpC3 PE=3 SV=1 876 1075 9.0E-08
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 881 1098 9.0E-08
sp|A2RI02|ECFA2_LACLM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ecfA2 PE=1 SV=1 886 1110 9.0E-08
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 517 735 9.0E-08
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 1189 1399 9.0E-08
sp|Q032H3|ECFA2_LACLS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ecfA2 PE=3 SV=1 886 1110 1.0E-07
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 888 1087 1.0E-07
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 886 1087 1.0E-07
sp|Q8G838|Y043_BIFLO Putative ABC transporter ATP-binding protein BL0043 OS=Bifidobacterium longum (strain NCC 2705) GN=BL0043 PE=3 SV=2 885 1068 1.0E-07
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 874 1087 1.0E-07
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 878 1042 1.0E-07
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 878 1042 1.0E-07
sp|Q31VE6|NIKE_SHIBS Nickel import ATP-binding protein NikE OS=Shigella boydii serotype 4 (strain Sb227) GN=nikE PE=3 SV=1 881 1098 1.0E-07
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 882 1087 1.0E-07
sp|Q4AA74|ECFA2_MYCHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ecfA2 PE=3 SV=1 875 1095 1.0E-07
sp|Q601T6|ECFA2_MYCH2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain 232) GN=ecfA2 PE=3 SV=1 875 1095 1.0E-07
sp|Q88J90|RBSA_PSEPK Ribose import ATP-binding protein RbsA OS=Pseudomonas putida (strain KT2440) GN=rbsA PE=3 SV=1 886 1068 1.0E-07
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 886 1087 1.0E-07
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 887 1068 1.0E-07
sp|Q73KT5|Y2132_TREDE Putative ABC transporter ATP-binding protein TDE_2132 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2132 PE=3 SV=1 885 1069 1.0E-07
sp|Q92CK1|Y1170_LISIN Putative ABC transporter ATP-binding protein lin1170 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1170 PE=3 SV=1 885 1087 1.0E-07
sp|Q0PAR0|MACB_CAMJE Macrolide export ATP-binding/permease protein MacB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=macB PE=3 SV=1 887 1070 1.0E-07
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 887 1095 1.0E-07
sp|Q4A8A1|ECFA2_MYCH7 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain 7448) GN=ecfA2 PE=3 SV=1 875 1095 1.0E-07
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 882 1087 1.0E-07
sp|Q03EE4|ECFA_PEDPA Energy-coupling factor transporter ATP-binding protein EcfA OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ecfA PE=3 SV=1 885 1056 1.0E-07
sp|Q6HNE7|RBSA_BACHK Ribose import ATP-binding protein RbsA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rbsA PE=3 SV=1 873 1087 1.0E-07
sp|Q81V36|RBSA_BACAN Ribose import ATP-binding protein RbsA OS=Bacillus anthracis GN=rbsA PE=3 SV=2 873 1087 1.0E-07
sp|Q2NUD6|MGLA_SODGM Galactose/methyl galactoside import ATP-binding protein MglA OS=Sodalis glossinidius (strain morsitans) GN=mglA PE=3 SV=1 886 1087 1.0E-07
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 885 1095 1.0E-07
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 885 1095 1.0E-07
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 885 1095 1.0E-07
sp|Q14H97|METN_FRAT1 Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=metN PE=3 SV=2 887 1091 1.0E-07
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 888 1096 1.0E-07
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 878 1042 1.0E-07
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 886 1087 1.0E-07
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 887 1068 1.0E-07
sp|Q97WT4|Y2030_SULSO Putative ABC transporter ATP-binding protein SSO2030 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2030 PE=3 SV=1 878 1095 1.0E-07
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 887 1068 1.0E-07
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 887 1068 1.0E-07
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 887 1068 1.0E-07
sp|Q8EEV5|LOLD_SHEON Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella oneidensis (strain MR-1) GN=lolD PE=3 SV=1 886 1087 1.0E-07
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 884 1073 1.0E-07
sp|Q5HVG3|MACB_CAMJR Macrolide export ATP-binding/permease protein MacB OS=Campylobacter jejuni (strain RM1221) GN=macB PE=3 SV=1 887 1070 1.0E-07
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 878 1091 1.0E-07
sp|Q4KKK4|ZNUC_PSEF5 Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=znuC PE=3 SV=1 885 1086 1.0E-07
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 886 1088 1.0E-07
sp|P51241|ABCX_PORPU Probable ATP-dependent transporter ycf16 OS=Porphyra purpurea GN=ycf16 PE=3 SV=1 195 426 2.0E-07
sp|Q0HVQ0|LOLD_SHESR Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-7) GN=lolD PE=3 SV=2 886 1087 2.0E-07
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 873 1087 2.0E-07
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 206 412 2.0E-07
sp|Q92LU2|MODC_RHIME Molybdenum import ATP-binding protein ModC OS=Rhizobium meliloti (strain 1021) GN=modC PE=3 SV=1 898 1087 2.0E-07
sp|Q6D0F3|THIQ_PECAS Thiamine import ATP-binding protein ThiQ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thiQ PE=3 SV=2 193 411 2.0E-07
sp|Q63FX9|RBSA_BACCZ Ribose import ATP-binding protein RbsA OS=Bacillus cereus (strain ZK / E33L) GN=rbsA PE=3 SV=1 873 1087 2.0E-07
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 887 1091 2.0E-07
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 877 1087 2.0E-07
sp|Q6VMN4|XYLG_THEP3 Xylose import ATP-binding protein XylG OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=xylG PE=3 SV=1 875 1087 2.0E-07
sp|Q9KXJ6|Y2324_STRCO Putative ABC transporter ATP-binding protein SCO2324 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2324 PE=3 SV=1 895 1094 2.0E-07
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 193 412 3.0E-07
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 203 406 3.0E-07
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 196 415 4.0E-07
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 1141 1325 7.0E-07
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 203 407 8.0E-07
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 203 407 8.0E-07
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 203 407 8.0E-07
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 185 412 9.0E-07
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 203 407 9.0E-07
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 872 1087 1.0E-06
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 186 357 1.0E-06
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 186 406 1.0E-06
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 583 812 1.0E-06
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 185 412 1.0E-06
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 466 732 1.0E-06
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 887 1074 1.0E-06
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 185 412 2.0E-06
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 872 1087 9.0E-06
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 890 1068 1.0E-05
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 888 1087 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 540 562 22
2 569 591 22
3 618 640 22
4 653 675 22
5 680 702 22
6 786 808 22
7 1205 1227 22
8 1239 1258 19
9 1291 1313 22
10 1320 1342 22
11 1357 1379 22
12 1472 1494 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10424
MSIPSDNGGGTAAGSPPHSGRSDPSRPRGGETKETEDESSPLSTASTPPLKDEGSESPGSMESSGERRAERDEGM
MGEDDRSELVRIATALSQRRSNVGGRAGHTSTVLEPIDEYDPALDPEKSEFELSKWLRRFIKQLQEQGVQERRMD
VAFRNLDVFGSGSALQLQQTVGSMFTAPLRPGEFFSFGRKDPKHILNGFEGFLPSGELLIVLGRPGSGCSTLLKT
ICGELDGLQLSEGSSVHYNGIPLKRMQKEFKGEFVYNQEVDKHFPHLTVGQTLEFAASARTPSHRIEGLSRKDYC
RYIARVVMTVFGLSHTYNTKVGNDFVRGVSGGERKRVSIAEMIVAGSPFSAWDNSTRGLDSATALKFVQSLRTAC
DLGAHANAVAIYQASQAIYDLFDRAIVLYEGRQIYYGRADRAKAFFEKQGWYCPPRQTTGDFLTSITNPQERQPR
KGMENRTPRTPEDFEAYWHASDEHQELMDELDRHEQQLSEQQHQNMAQFREQKNFLQSRHTRPKSPYLISIWMQV
KLNTKRAYQRMWNDISAPMTQTMSQLVMALIIGSMFYDTPDATVGFYAKGSVLFLAILMNALTAISEISSLYAQR
PIVEKHHSYAFYHPSTEAMAGIVADIPIKFATSTVFNIVLYFLSNLRREPSQFFIYFLITYMSIFVMSAVFRTMA
AATRTISQAMALAGVLVLALVIYTGFAIRVPQMHHYFSWIRWINPIFYAFEILIANEFHGREFTCSAIVPPYSPP
QGDSWICDASGAVAGRPTVSGDAFIYADYRYRYSHVWRNFGILIAFLIFFMCVYFLVTEINSSTTSTAEALVFQR
GHVPAHLQKGHKKAVHKDDDAAAGPAANNGQEHVQALAPQTDIFTWRDVVYDIEIKGQPRRLLDNVSGWVKPGTL
TALMGVSGAGKTTLLDVLAQRTTMGVITGDMLVNGKPRDPSFQRKTGYVQQQDLHLETATVRESLRFSAMLRQPP
TVSKKEKYAFVEDVIKMLNMEEFSNAIVGVPGEGLNVEQRKLLTIGVELAAKPKLLLFLDEPTSGLDSQSSWAIC
SFLRKLADSGQAILCTVHQPSAILFQSFDRLLFLARGGKTVYFGNIGDNSRTLLDYFEAHGARSCGDEENPAEYM
LEVVNYGYNDKGQDWHSVWKESSEVGAVHTELERIHSERRHEGNGSDEHDSHSSSEFAMPFRDQLGVVTYRIFQQ
YWRMPSYIFAKFALAIVAGLFIGFTFYNAKDTLAGTQDVIYSVFMVTTLFTTLVQQIQPLFVTQRALYEVRERPS
KCYSWVAFIISNIVVEIPYQIFTGILIWACFYYPVVGVQSSQRQGLVLLFVVQLLIYCSAFAHMTIVTMPDAHTA
ASVVTVLSIMSIIFNGVLQTPSALPGFWIFMYRVSPFTYWIGGIVATELHGRTINCSDEETRVFDPPQGMSCGQY
MAPYLQTATGRLLNPDDNSQCRYCTVRNADQTLVASEIYWGDRWRNYGIFWAFIAFDIFAAVALYYLFRVKTWNL
ASLNPMRLMPKSKKGEKGDKADKGEKSEKSEKSEQSES*
Coding >Hirsu2|10424
ATGTCGATTCCCTCGGACAATGGCGGGGGGACGGCGGCTGGCTCCCCCCCGCATAGCGGCAGGTCGGATCCCAGC
CGGCCTCGTGGCGGGGAGACGAAGGAGACAGAGGACGAGAGCAGCCCGCTGTCGACGGCGAGCACACCGCCACTC
AAAGACGAGGGCTCCGAGTCTCCTGGTTCGATGGAGTCGAGCGGCGAGCGGCGGGCGGAGCGGGACGAGGGGATG
ATGGGCGAGGACGACCGGTCGGAGCTGGTGCGGATCGCGACGGCGCTGTCGCAGCGGCGGTCCAACGTCGGCGGC
CGGGCCGGCCACACGAGCACGGTGCTGGAGCCCATCGACGAGTACGACCCGGCGCTGGACCCGGAGAAGAGCGAG
TTCGAGCTCTCCAAGTGGCTGCGCCGCTTCATCAAGCAGCTGCAGGAGCAGGGCGTCCAGGAGCGGCGGATGGAC
GTGGCCTTCCGCAACCTCGACGTCTTCGGCTCCGGCTCGGCCCTGCAGCTGCAGCAGACGGTCGGCTCCATGTTC
ACGGCGCCGCTGCGGCCCGGCGAATTCTTCAGCTTCGGCCGCAAGGACCCCAAGCACATCCTCAACGGCTTCGAG
GGCTTCCTGCCCAGCGGCGAGCTGCTCATCGTCCTCGGACGGCCCGGCTCCGGCTGCAGCACCTTGCTCAAGACC
ATCTGCGGCGAGCTCGACGGCCTGCAGCTCAGCGAGGGCTCGAGCGTGCACTACAACGGCATTCCGCTGAAGCGG
ATGCAGAAGGAGTTCAAGGGCGAGTTTGTCTACAACCAAGAGGTGGACAAGCACTTCCCCCATCTCACCGTCGGT
CAGACGCTCGAGTTCGCCGCCTCGGCCCGCACGCCCTCGCACCGGATCGAGGGCCTGTCCCGCAAAGACTACTGC
CGCTACATCGCGCGCGTCGTCATGACCGTCTTCGGGCTGAGCCACACGTACAACACAAAGGTCGGCAACGACTTC
GTCCGCGGCGTCTCGGGCGGCGAGAGGAAGCGGGTCAGCATCGCCGAGATGATCGTCGCCGGCTCCCCCTTCTCC
GCCTGGGACAACAGCACGCGCGGCCTCGACTCGGCCACGGCCCTCAAGTTCGTCCAGTCGCTGCGCACGGCGTGC
GACCTCGGCGCGCACGCCAACGCCGTCGCCATCTACCAGGCCAGCCAGGCCATCTACGACCTGTTCGACAGGGCC
ATCGTCCTGTACGAGGGCCGGCAGATCTACTACGGGCGCGCCGACCGGGCCAAGGCCTTCTTCGAGAAGCAGGGC
TGGTACTGCCCGCCGCGGCAGACGACCGGCGATTTCCTCACCTCCATCACGAACCCGCAGGAGCGGCAGCCGCGC
AAGGGCATGGAGAACCGCACGCCGCGCACGCCCGAGGACTTCGAGGCGTACTGGCACGCCTCGGACGAGCACCAG
GAGCTGATGGACGAGCTGGACCGGCACGAGCAGCAGCTGAGCGAGCAGCAGCATCAGAACATGGCTCAGTTCCGC
GAGCAGAAGAACTTCCTCCAGTCGCGGCACACCCGGCCCAAGAGCCCCTATCTCATCAGCATCTGGATGCAGGTC
AAGCTCAACACCAAGCGCGCCTACCAGCGCATGTGGAACGACATCTCGGCCCCCATGACGCAGACCATGTCGCAG
CTGGTCATGGCCCTCATCATCGGCTCCATGTTCTACGACACGCCCGACGCGACCGTCGGCTTCTACGCCAAGGGC
TCCGTTCTCTTCCTCGCCATCCTGATGAACGCGCTGACGGCCATCTCCGAGATCAGCAGCCTGTATGCGCAGCGG
CCCATCGTGGAGAAGCACCACTCGTACGCCTTCTACCATCCTTCGACTGAGGCCATGGCCGGTATCGTGGCCGAC
ATCCCCATCAAGTTTGCCACATCGACCGTCTTCAACATCGTGCTGTACTTCCTGTCCAACCTGCGGCGCGAGCCA
TCGCAGTTCTTCATCTACTTCCTCATCACCTACATGTCCATCTTCGTCATGAGCGCCGTCTTCCGTACCATGGCC
GCCGCCACCCGCACCATCTCGCAGGCCATGGCCCTGGCCGGCGTCCTGGTCCTCGCCCTGGTCATCTACACGGGC
TTCGCCATCCGTGTGCCGCAGATGCATCATTACTTCTCCTGGATTCGCTGGATCAACCCCATCTTCTACGCCTTC
GAGATCCTCATCGCCAACGAGTTCCACGGCCGCGAGTTCACCTGCTCCGCCATCGTCCCGCCCTACTCGCCGCCC
CAGGGCGACTCCTGGATATGCGACGCCTCGGGCGCCGTGGCCGGCCGCCCGACCGTGAGCGGCGATGCCTTCATC
TACGCCGACTACCGCTACCGTTACAGCCACGTCTGGCGCAACTTCGGCATCCTCATCGCCTTCCTCATTTTCTTC
ATGTGCGTCTACTTCTTGGTCACGGAGATCAACTCGTCCACGACCAGCACGGCCGAGGCTCTCGTCTTCCAGCGT
GGCCATGTGCCGGCCCACCTGCAGAAGGGTCACAAGAAGGCGGTTCATAAAGACGACGACGCCGCAGCTGGGCCT
GCCGCCAACAACGGTCAGGAGCACGTCCAGGCCCTGGCTCCGCAGACGGACATCTTCACCTGGCGCGACGTCGTC
TACGACATAGAGATCAAGGGCCAGCCGCGCCGCCTTCTCGACAACGTCTCCGGCTGGGTCAAGCCCGGAACGCTG
ACGGCGCTCATGGGCGTGTCTGGTGCCGGCAAGACGACGCTTCTCGATGTCCTGGCTCAGCGGACGACGATGGGC
GTTATCACGGGTGATATGCTGGTCAACGGCAAGCCGCGCGACCCCAGCTTCCAGCGCAAGACGGGCTACGTGCAG
CAGCAGGACTTACATCTCGAGACGGCCACGGTCCGTGAGAGTCTGCGGTTCAGCGCCATGCTCCGTCAGCCGCCG
ACGGTTAGCAAGAAAGAGAAATACGCCTTCGTTGAGGACGTCATTAAAATGCTCAATATGGAGGAATTCTCCAAC
GCCATCGTTGGCGTCCCTGGCGAGGGACTGAACGTCGAGCAGCGCAAGCTATTGACCATTGGCGTCGAGCTGGCG
GCGAAGCCCAAACTGCTACTCTTCCTCGACGAACCGACGAGCGGCCTCGACTCGCAGAGCTCCTGGGCCATCTGC
TCCTTTCTACGCAAGCTGGCCGATTCGGGCCAGGCCATTCTCTGCACAGTCCATCAGCCCAGCGCCATTCTCTTT
CAGTCCTTCGACCGCCTGCTCTTCCTCGCCCGCGGCGGCAAGACGGTCTACTTCGGCAATATCGGCGATAACTCG
CGCACCCTGCTCGACTACTTTGAGGCTCATGGGGCGCGTTCCTGCGGCGACGAAGAGAACCCGGCCGAGTACATG
CTCGAGGTTGTCAACTACGGCTACAACGACAAGGGCCAAGACTGGCACTCGGTCTGGAAGGAGAGCAGCGAGGTC
GGTGCCGTTCACACCGAGCTTGAGCGCATCCACAGCGAGAGGCGTCACGAGGGCAACGGTTCCGACGAGCACGAC
AGCCACAGCAGCTCCGAGTTCGCCATGCCCTTTAGGGACCAGCTCGGTGTCGTCACCTACCGCATCTTCCAGCAG
TACTGGCGCATGCCGAGCTACATCTTCGCCAAGTTCGCGCTCGCCATCGTCGCCGGCCTGTTTATCGGCTTCACC
TTCTACAACGCCAAGGATACCCTCGCCGGCACCCAGGACGTCATTTACTCCGTCTTCATGGTCACCACCCTCTTC
ACCACGCTCGTCCAGCAGATCCAACCTCTGTTCGTCACCCAGCGCGCTCTGTACGAGGTTCGCGAGCGGCCGAGC
AAGTGCTACTCGTGGGTGGCCTTTATCATCTCCAACATCGTCGTCGAGATCCCCTACCAGATCTTCACTGGCATC
CTCATCTGGGCCTGCTTCTACTACCCGGTCGTCGGCGTCCAGAGCTCTCAACGCCAGGGCCTGGTCCTGCTCTTT
GTCGTCCAGCTGCTCATCTACTGCTCGGCCTTCGCTCACATGACCATCGTGACAATGCCCGACGCCCACACCGCC
GCCAGCGTCGTCACCGTCCTGTCCATCATGAGCATCATCTTTAACGGCGTCCTGCAGACGCCGTCTGCGTTGCCC
GGCTTCTGGATCTTCATGTACCGCGTCTCACCCTTCACCTATTGGATCGGCGGTATCGTCGCCACCGAGCTGCAC
GGCCGCACCATCAACTGCTCAGACGAGGAAACGCGCGTCTTCGACCCGCCACAGGGGATGTCCTGCGGCCAGTAC
ATGGCCCCTTATCTGCAGACGGCCACCGGACGGCTGCTTAACCCGGACGACAACTCGCAGTGCCGCTACTGCACC
GTCAGAAACGCCGACCAGACCCTGGTTGCCTCCGAAATCTACTGGGGCGACCGCTGGCGCAACTACGGCATCTTC
TGGGCCTTCATTGCCTTCGACATCTTTGCTGCCGTCGCTCTTTACTATCTATTCAGGGTCAAGACATGGAACTTG
GCTTCGCTTAACCCCATGAGATTGATGCCGAAGAGCAAGAAGGGCGAGAAGGGAGACAAGGCAGACAAGGGCGAG
AAGAGCGAGAAAAGCGAGAAAAGTGAGCAGAGCGAGTCTTAA
Transcript >Hirsu2|10424
ATGTCGATTCCCTCGGACAATGGCGGGGGGACGGCGGCTGGCTCCCCCCCGCATAGCGGCAGGTCGGATCCCAGC
CGGCCTCGTGGCGGGGAGACGAAGGAGACAGAGGACGAGAGCAGCCCGCTGTCGACGGCGAGCACACCGCCACTC
AAAGACGAGGGCTCCGAGTCTCCTGGTTCGATGGAGTCGAGCGGCGAGCGGCGGGCGGAGCGGGACGAGGGGATG
ATGGGCGAGGACGACCGGTCGGAGCTGGTGCGGATCGCGACGGCGCTGTCGCAGCGGCGGTCCAACGTCGGCGGC
CGGGCCGGCCACACGAGCACGGTGCTGGAGCCCATCGACGAGTACGACCCGGCGCTGGACCCGGAGAAGAGCGAG
TTCGAGCTCTCCAAGTGGCTGCGCCGCTTCATCAAGCAGCTGCAGGAGCAGGGCGTCCAGGAGCGGCGGATGGAC
GTGGCCTTCCGCAACCTCGACGTCTTCGGCTCCGGCTCGGCCCTGCAGCTGCAGCAGACGGTCGGCTCCATGTTC
ACGGCGCCGCTGCGGCCCGGCGAATTCTTCAGCTTCGGCCGCAAGGACCCCAAGCACATCCTCAACGGCTTCGAG
GGCTTCCTGCCCAGCGGCGAGCTGCTCATCGTCCTCGGACGGCCCGGCTCCGGCTGCAGCACCTTGCTCAAGACC
ATCTGCGGCGAGCTCGACGGCCTGCAGCTCAGCGAGGGCTCGAGCGTGCACTACAACGGCATTCCGCTGAAGCGG
ATGCAGAAGGAGTTCAAGGGCGAGTTTGTCTACAACCAAGAGGTGGACAAGCACTTCCCCCATCTCACCGTCGGT
CAGACGCTCGAGTTCGCCGCCTCGGCCCGCACGCCCTCGCACCGGATCGAGGGCCTGTCCCGCAAAGACTACTGC
CGCTACATCGCGCGCGTCGTCATGACCGTCTTCGGGCTGAGCCACACGTACAACACAAAGGTCGGCAACGACTTC
GTCCGCGGCGTCTCGGGCGGCGAGAGGAAGCGGGTCAGCATCGCCGAGATGATCGTCGCCGGCTCCCCCTTCTCC
GCCTGGGACAACAGCACGCGCGGCCTCGACTCGGCCACGGCCCTCAAGTTCGTCCAGTCGCTGCGCACGGCGTGC
GACCTCGGCGCGCACGCCAACGCCGTCGCCATCTACCAGGCCAGCCAGGCCATCTACGACCTGTTCGACAGGGCC
ATCGTCCTGTACGAGGGCCGGCAGATCTACTACGGGCGCGCCGACCGGGCCAAGGCCTTCTTCGAGAAGCAGGGC
TGGTACTGCCCGCCGCGGCAGACGACCGGCGATTTCCTCACCTCCATCACGAACCCGCAGGAGCGGCAGCCGCGC
AAGGGCATGGAGAACCGCACGCCGCGCACGCCCGAGGACTTCGAGGCGTACTGGCACGCCTCGGACGAGCACCAG
GAGCTGATGGACGAGCTGGACCGGCACGAGCAGCAGCTGAGCGAGCAGCAGCATCAGAACATGGCTCAGTTCCGC
GAGCAGAAGAACTTCCTCCAGTCGCGGCACACCCGGCCCAAGAGCCCCTATCTCATCAGCATCTGGATGCAGGTC
AAGCTCAACACCAAGCGCGCCTACCAGCGCATGTGGAACGACATCTCGGCCCCCATGACGCAGACCATGTCGCAG
CTGGTCATGGCCCTCATCATCGGCTCCATGTTCTACGACACGCCCGACGCGACCGTCGGCTTCTACGCCAAGGGC
TCCGTTCTCTTCCTCGCCATCCTGATGAACGCGCTGACGGCCATCTCCGAGATCAGCAGCCTGTATGCGCAGCGG
CCCATCGTGGAGAAGCACCACTCGTACGCCTTCTACCATCCTTCGACTGAGGCCATGGCCGGTATCGTGGCCGAC
ATCCCCATCAAGTTTGCCACATCGACCGTCTTCAACATCGTGCTGTACTTCCTGTCCAACCTGCGGCGCGAGCCA
TCGCAGTTCTTCATCTACTTCCTCATCACCTACATGTCCATCTTCGTCATGAGCGCCGTCTTCCGTACCATGGCC
GCCGCCACCCGCACCATCTCGCAGGCCATGGCCCTGGCCGGCGTCCTGGTCCTCGCCCTGGTCATCTACACGGGC
TTCGCCATCCGTGTGCCGCAGATGCATCATTACTTCTCCTGGATTCGCTGGATCAACCCCATCTTCTACGCCTTC
GAGATCCTCATCGCCAACGAGTTCCACGGCCGCGAGTTCACCTGCTCCGCCATCGTCCCGCCCTACTCGCCGCCC
CAGGGCGACTCCTGGATATGCGACGCCTCGGGCGCCGTGGCCGGCCGCCCGACCGTGAGCGGCGATGCCTTCATC
TACGCCGACTACCGCTACCGTTACAGCCACGTCTGGCGCAACTTCGGCATCCTCATCGCCTTCCTCATTTTCTTC
ATGTGCGTCTACTTCTTGGTCACGGAGATCAACTCGTCCACGACCAGCACGGCCGAGGCTCTCGTCTTCCAGCGT
GGCCATGTGCCGGCCCACCTGCAGAAGGGTCACAAGAAGGCGGTTCATAAAGACGACGACGCCGCAGCTGGGCCT
GCCGCCAACAACGGTCAGGAGCACGTCCAGGCCCTGGCTCCGCAGACGGACATCTTCACCTGGCGCGACGTCGTC
TACGACATAGAGATCAAGGGCCAGCCGCGCCGCCTTCTCGACAACGTCTCCGGCTGGGTCAAGCCCGGAACGCTG
ACGGCGCTCATGGGCGTGTCTGGTGCCGGCAAGACGACGCTTCTCGATGTCCTGGCTCAGCGGACGACGATGGGC
GTTATCACGGGTGATATGCTGGTCAACGGCAAGCCGCGCGACCCCAGCTTCCAGCGCAAGACGGGCTACGTGCAG
CAGCAGGACTTACATCTCGAGACGGCCACGGTCCGTGAGAGTCTGCGGTTCAGCGCCATGCTCCGTCAGCCGCCG
ACGGTTAGCAAGAAAGAGAAATACGCCTTCGTTGAGGACGTCATTAAAATGCTCAATATGGAGGAATTCTCCAAC
GCCATCGTTGGCGTCCCTGGCGAGGGACTGAACGTCGAGCAGCGCAAGCTATTGACCATTGGCGTCGAGCTGGCG
GCGAAGCCCAAACTGCTACTCTTCCTCGACGAACCGACGAGCGGCCTCGACTCGCAGAGCTCCTGGGCCATCTGC
TCCTTTCTACGCAAGCTGGCCGATTCGGGCCAGGCCATTCTCTGCACAGTCCATCAGCCCAGCGCCATTCTCTTT
CAGTCCTTCGACCGCCTGCTCTTCCTCGCCCGCGGCGGCAAGACGGTCTACTTCGGCAATATCGGCGATAACTCG
CGCACCCTGCTCGACTACTTTGAGGCTCATGGGGCGCGTTCCTGCGGCGACGAAGAGAACCCGGCCGAGTACATG
CTCGAGGTTGTCAACTACGGCTACAACGACAAGGGCCAAGACTGGCACTCGGTCTGGAAGGAGAGCAGCGAGGTC
GGTGCCGTTCACACCGAGCTTGAGCGCATCCACAGCGAGAGGCGTCACGAGGGCAACGGTTCCGACGAGCACGAC
AGCCACAGCAGCTCCGAGTTCGCCATGCCCTTTAGGGACCAGCTCGGTGTCGTCACCTACCGCATCTTCCAGCAG
TACTGGCGCATGCCGAGCTACATCTTCGCCAAGTTCGCGCTCGCCATCGTCGCCGGCCTGTTTATCGGCTTCACC
TTCTACAACGCCAAGGATACCCTCGCCGGCACCCAGGACGTCATTTACTCCGTCTTCATGGTCACCACCCTCTTC
ACCACGCTCGTCCAGCAGATCCAACCTCTGTTCGTCACCCAGCGCGCTCTGTACGAGGTTCGCGAGCGGCCGAGC
AAGTGCTACTCGTGGGTGGCCTTTATCATCTCCAACATCGTCGTCGAGATCCCCTACCAGATCTTCACTGGCATC
CTCATCTGGGCCTGCTTCTACTACCCGGTCGTCGGCGTCCAGAGCTCTCAACGCCAGGGCCTGGTCCTGCTCTTT
GTCGTCCAGCTGCTCATCTACTGCTCGGCCTTCGCTCACATGACCATCGTGACAATGCCCGACGCCCACACCGCC
GCCAGCGTCGTCACCGTCCTGTCCATCATGAGCATCATCTTTAACGGCGTCCTGCAGACGCCGTCTGCGTTGCCC
GGCTTCTGGATCTTCATGTACCGCGTCTCACCCTTCACCTATTGGATCGGCGGTATCGTCGCCACCGAGCTGCAC
GGCCGCACCATCAACTGCTCAGACGAGGAAACGCGCGTCTTCGACCCGCCACAGGGGATGTCCTGCGGCCAGTAC
ATGGCCCCTTATCTGCAGACGGCCACCGGACGGCTGCTTAACCCGGACGACAACTCGCAGTGCCGCTACTGCACC
GTCAGAAACGCCGACCAGACCCTGGTTGCCTCCGAAATCTACTGGGGCGACCGCTGGCGCAACTACGGCATCTTC
TGGGCCTTCATTGCCTTCGACATCTTTGCTGCCGTCGCTCTTTACTATCTATTCAGGGTCAAGACATGGAACTTG
GCTTCGCTTAACCCCATGAGATTGATGCCGAAGAGCAAGAAGGGCGAGAAGGGAGACAAGGCAGACAAGGGCGAG
AAGAGCGAGAAAAGCGAGAAAAGTGAGCAGAGCGAGTCTTAA
Gene >Hirsu2|10424
ATGTCGATTCCCTCGGACAATGGCGGGGGGACGGCGGCTGGCTCCCCCCCGCATAGCGGCAGGTCGGATCCCAGC
CGGCCTCGTGGCGGGGAGACGAAGGAGACAGAGGACGAGAGCAGCCCGCTGTCGACGGCGAGCACACCGCCACTC
AAAGACGAGGGCTCCGAGTCTCCTGGTTCGATGGAGTCGAGCGGCGAGCGGCGGGCGGAGCGGGACGAGGGGATG
ATGGGCGAGGACGACCGGTCGGAGCTGGTGCGGATCGCGACGGCGCTGTCGCAGCGGCGGTCCAACGTCGGCGGC
CGGGCCGGCCACACGAGCACGGTGCTGGAGCCCATCGACGAGTACGACCCGGCGCTGGACCCGGAGAAGAGCGAG
TTCGAGCTCTCCAAGTGGCTGCGCCGCTTCATCAAGCAGCTGCAGGAGCAGGGCGTCCAGGAGCGGCGGATGGAC
GTGGCCTTCCGCAACCTCGACGTCTTCGGCTCCGGCTCGGCCCTGCAGCTGCAGCAGACGGTCGGCTCCATGTTC
ACGGCGCCGCTGCGGCCCGGCGAATTCTTCAGCTTCGGCCGCAAGGACCCCAAGCACATCCTCAACGGCTTCGAG
GGCTTCCTGCCCAGCGGCGAGCTGCTCATCGTCCTCGGACGGCCCGGCTCCGGCTGCAGCACCTTGCTCAAGACC
ATCTGCGGCGAGCTCGACGGCCTGCAGCTCAGCGAGGGCTCGAGCGTGCACTACAACGGCATTCCGCTGAAGCGG
ATGCAGAAGGAGTTCAAGGGCGAGTTTGTCTACAACCAAGAGGTCGGTGTTTTCCCTCCGTCTGCCTTTTTTGTT
TCCGGTGCTCTTTCGGGTACATGAGGCTTTCTCTACATGTATATGCCGTGTCAACTCGACAAACCAACTACATCA
GCATGCGTTCGATCTACTGACAGCAACTCTCCGCAACTCTAGGTGGACAAGCACTTCCCCCATCTCACCGTCGGT
CAGACGCTCGAGTTCGCCGCCTCGGCCCGCACGCCCTCGCACCGGATCGAGGGCCTGTCCCGCAAAGACTACTGC
CGCTACATCGCGCGCGTCGTCATGACCGTCTTCGGGCTGAGCCACACGTACAACACAAAGGTCGGCAACGACTTC
GTCCGCGGCGTCTCGGGCGGCGAGAGGAAGCGGGTCAGCATCGCCGAGATGATCGTCGCCGGCTCCCCCTTCTCC
GCCTGGGACAACAGCACGCGCGGCCTCGACTCGGCCACGGCCCTCAAGTTCGTCCAGTCGCTGCGCACGGCGTGC
GACCTCGGCGCGCACGCCAACGCCGTCGCCATCTACCAGGCCAGCCAGGCCATCTACGACCTGTTCGACAGGGCC
ATCGTCCTGTACGAGGGCCGGCAGATCTACTACGGGCGCGCCGACCGGGCCAAGGCCTTCTTCGAGAAGCAGGGC
TGGTACTGCCCGCCGCGGCAGACGACCGGCGATTTCCTCACCTCCATCACGAACCCGCAGGAGCGGCAGCCGCGC
AAGGGCATGGAGAACCGCACGCCGCGCACGCCCGAGGACTTCGAGGCGTACTGGCACGCCTCGGACGAGCACCAG
GAGCTGATGGACGAGCTGGACCGGCACGAGCAGCAGCTGAGCGAGCAGCAGCATCAGAACATGGCTCAGTTCCGC
GAGCAGAAGAACTTCCTCCAGTCGCGGCACACCCGGCCCAAGAGCCCCTATCTCATCAGCATCTGGATGCAGGTC
AAGCTCAACACCAAGCGCGCCTACCAGCGCATGTGGAACGACATCTCGGCCCCCATGACGCAGACCATGTCGCAG
CTGGTCATGGCCCTCATCATCGGCTCCATGTTCTACGACACGCCCGACGCGACCGTCGGCTTCTACGCCAAGGGC
TCCGTTCTCTTCCTCGCCATCCTGATGAACGCGCTGACGGCCATCTCCGAGATCAGCAGCCTGTATGCGCAGCGG
CCCATCGTGGAGAAGCACCACTCGTACGCCTTCTACCATCCTTCGACTGAGGCCATGGCCGGTATCGTGGCCGAC
ATCCCCATCAAGTTTGCCACATCGACCGTCTTCAACATCGTGCTGTACTTCCTGTCCAACCTGCGGCGCGAGCCA
TCGCAGTTCTTCATCTACTTCCTCATCACCTACATGTCCATCTTCGTCATGAGCGCCGTCTTCCGTACCATGGCC
GCCGCCACCCGCACCATCTCGCAGGCCATGGCCCTGGCCGGCGTCCTGGTCCTCGCCCTGGTCATCTACACGGGC
TTCGCCATCCGTGTGCCGCAGATGCATCATTACTTCTCCTGGATTCGCTGGATCAACCCCATCTTCTACGCCTTC
GAGATCCTCATCGCCAACGAGTTCCACGGCCGCGAGTTCACCTGCTCCGCCATCGTCCCGCCCTACTCGCCGCCC
CAGGGCGACTCCTGGATATGCGACGCCTCGGGCGCCGTGGCCGGCCGCCCGACCGTGAGCGGCGATGCCTTCATC
TACGCCGACTACCGCTACCGTTACAGCCACGTCTGGCGCAACTTCGGCATCCTCATCGCCTTCCTCATTTTCTTC
ATGTGCGTCTACTTCTTGGTCACGGAGATCAACTCGTCCACGACCAGCACGGCCGAGGCTCTCGTCTTCCAGCGT
GGCCATGTGCCGGCCCACCTGCAGAAGGGTCACAAGAAGGCGGTTCATAAAGACGACGACGCCGCAGCTGGGCCT
GCCGCCAACAACGGTCAGGAGCACGTCCAGGCCCTGGCTCCGCAGACGGACATCTTCACCTGGCGCGACGTCGTC
TACGACATAGAGATCAAGGGCCAGCCGCGCCGCCTTCTCGACAACGTCTCCGGCTGGGTCAAGCCCGGAACGCTG
ACGGCGCTCATGGGCGTGTCTGGTGCCGGCAAGACGACGCTTCTCGATGTCCTGGCTCAGCGGACGACGATGGGC
GTTATCACGGGTGATATGCTGGTCAACGGCAAGCCGCGCGACCCCAGCTTCCAGCGCAAGACGGGCTACGTGCAG
CAGCAGGGTAAGCTGCTCCTTTCCCCCCCTCTCCTCTTCCTCCTTGAGCTCCCCCTCAAGCCCCTCCTCACGCTT
CTCCCTTCTCGTCTCTTCCGGTGCCCGTCGAGAGATTCGACTAACGATGAATGTCCCGCCTAGACTTACATCTCG
AGACGGCCACGGTCCGTGAGAGTCTGCGGTTCAGCGCCATGCTCCGTCAGCCGCCGACGGTTAGCAAGAAAGAGA
AATACGCCTTCGTTGAGGACGTCATTAAAATGCTCAATATGGAGGAATTCTCCAACGCCATCGTTGGCGTCCCTG
GCGAGGGACTGAACGTCGAGCAGCGCAAGCTATTGACCATTGGCGTCGAGCTGGCGGCGAAGCCCAAACTGCTAC
TCTTCCTCGACGAACCGACGAGCGGCCTCGACTCGCAGAGCTCCTGGGCCATCTGCTCCTTTCTACGCAAGCTGG
CCGATTCGGGCCAGGCCATTCTCTGCACAGTCCATCAGCCCAGCGCCATTCTCTTTCAGTCCTTCGACCGCCTGC
TCTTCCTCGCCCGCGGCGGCAAGACGGTCTACTTCGGCAATATCGGCGATAACTCGCGCACCCTGCTCGACTACT
TTGAGGCTCATGGGGCGCGTTCCTGCGGCGACGAAGAGAACCCGGCCGAGTACATGCTCGAGGTTGTCAACTACG
GCTACAACGACAAGGGCCAAGACTGGCACTCGGTCTGGAAGGAGAGCAGCGAGGTCGGTGCCGTTCACACCGAGC
TTGAGCGCATCCACAGCGAGAGGCGTCACGAGGGCAACGGTTCCGACGAGCACGACAGCCACAGCAGCTCCGAGT
TCGCCATGCCCTTTAGGGACCAGCTCGGTGTCGTCACCTACCGCATCTTCCAGCAGTACTGGCGCATGCCGAGCT
ACATCTTCGCCAAGTTCGCGCTCGCCATCGTCGCCGGCCTGTTTATCGGCTTCACCTTCTACAACGCCAAGGATA
CCCTCGCCGGCACCCAGGACGTCATTTACTCCGTCTTCATGGTCACCACCCTCTTCACCACGCTCGTCCAGCAGG
TATGTCTCTGTCCTTATCGGCTTTTTTGCCGCTTCTTCTGTTCCCCCGTTCTGTCGTAATGCCTCCCACGTACCC
CGGAGACTGATCAAGATCGCAACCATAGATCCAACCTCTGTTCGTCACCCAGCGCGCTCTGTACGAGGTTCGCGA
GCGGCCGAGCAAGTGCTACTCGTGGGTGGCCTTTATCATCTCCAACATCGTCGTCGAGATCCCCTACCAGATCTT
CACTGGCATCCTCATCTGGGCCTGCTTCTACTACCCGGTCGTCGGCGTCCAGAGCTCTCAACGCCAGGGCCTGGT
CCTGCTCTTTGTCGTCCAGCTGCTCATCTACTGCTCGGCCTTCGCTCACATGACCATCGTGACAATGCCCGACGC
CCACACCGCCGCCAGCGTCGTCACCGTCCTGTCCATCATGAGCATCATCTTTAACGGCGTCCTGCAGACGCCGTC
TGCGTTGCCCGGCTTCTGGATCTTCATGTACCGCGTCTCACCCTTCACCTATTGGATCGGCGGTATCGTCGCCAC
CGAGCTGCACGGCCGCACCATCAACTGCTCAGACGAGGAAACGCGCGTCTTCGACCCGCCACAGGGGATGTCCTG
CGGCCAGTACATGGCCCCTTATCTGCAGACGGCCACCGGACGGCTGCTTAACCCGGACGACAACTCGCAGTGCCG
CTACTGCACCGTCAGAAACGCCGACCAGACCCTGGTTGCCTCCGAAATCTACTGGGGCGACCGCTGGCGCAACTA
CGGCATCTTCTGGGCCTTCATTGCCTTCGACATCTTTGCTGCCGTCGCTCTTTACTATCTATTCAGGGTCAAGAC
ATGGAACTTGGCTTCGCTTAACCCCATGAGATTGATGCCGAAGAGCAAGAAGGGCGAGAAGGGAGACAAGGCAGA
CAAGGGCGAGAAGAGCGAGAAAAGCGAGAAAAGTGAGCAGAGCGAGTCTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail