Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10423
Gene name
LocationContig_84:23883..25821
Strand+
Gene length (bp)1938
Transcript length (bp)1746
Coding sequence length (bp)1746
Protein length (aa) 582

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01425 Amidase Amidase 3.8E-61 76 374

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URY4|YI01_SCHPO Putative amidase C869.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.01 PE=3 SV=1 40 579 2.0E-179
sp|D4B3C8|A2965_ARTBC Putative amidase ARB_02965 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02965 PE=1 SV=1 54 574 7.0E-56
sp|A5FQ07|GATA_DEHMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=gatA PE=3 SV=1 55 302 2.0E-32
sp|Q3Z6V3|GATA_DEHM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gatA PE=3 SV=1 55 302 2.0E-32
sp|Q3ZYM5|GATA_DEHMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain CBDB1) GN=gatA PE=3 SV=1 55 302 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URY4|YI01_SCHPO Putative amidase C869.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.01 PE=3 SV=1 40 579 2.0E-179
sp|D4B3C8|A2965_ARTBC Putative amidase ARB_02965 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02965 PE=1 SV=1 54 574 7.0E-56
sp|A5FQ07|GATA_DEHMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=gatA PE=3 SV=1 55 302 2.0E-32
sp|Q3Z6V3|GATA_DEHM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gatA PE=3 SV=1 55 302 2.0E-32
sp|Q3ZYM5|GATA_DEHMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dehalococcoides mccartyi (strain CBDB1) GN=gatA PE=3 SV=1 55 302 2.0E-32
sp|Q97EX8|GATA2_CLOAB Glutamyl-tRNA(Gln) amidotransferase subunit A 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatA2 PE=3 SV=1 57 361 9.0E-32
sp|A2C1Y1|GATA_PROM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain NATL1A) GN=gatA PE=3 SV=1 59 568 3.0E-30
sp|Q46L72|GATA_PROMT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain NATL2A) GN=gatA PE=3 SV=1 59 568 5.0E-30
sp|Q67KJ2|GATA_SYMTH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gatA PE=3 SV=1 69 360 3.0E-29
sp|B1I3K2|GATA_DESAP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulforudis audaxviator (strain MP104C) GN=gatA PE=3 SV=1 53 567 3.0E-29
sp|Q73Q68|GATA_TREDE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gatA PE=3 SV=1 55 373 4.0E-29
sp|B2V855|GATA_SULSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=gatA PE=3 SV=1 57 359 5.0E-29
sp|A0Q2Q0|GATA_CLONN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium novyi (strain NT) GN=gatA PE=3 SV=1 81 360 2.0E-28
sp|Q88XP7|GATA_LACPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gatA PE=3 SV=1 60 360 3.0E-28
sp|Q12VH1|GATA_METBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gatA PE=3 SV=1 114 567 5.0E-28
sp|B0JSX3|GATA_MICAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Microcystis aeruginosa (strain NIES-843) GN=gatA PE=3 SV=1 59 360 7.0E-28
sp|Q8R679|GATA_FUSNN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gatA PE=3 SV=1 55 361 2.0E-27
sp|Q0VFI5|GATA_XENTR Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Xenopus tropicalis GN=qrsl1 PE=2 SV=1 52 361 2.0E-27
sp|C1D1L2|GATA_DEIDV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gatA PE=3 SV=1 59 310 2.0E-27
sp|Q6AQK1|GATA_DESPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gatA PE=3 SV=1 53 362 4.0E-27
sp|Q8PXJ1|GATA_METMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gatA PE=3 SV=1 59 359 4.0E-27
sp|Q03EG5|GATA_PEDPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gatA PE=3 SV=1 53 360 5.0E-27
sp|B7KLL5|GATA_CYAP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 7424) GN=gatA PE=3 SV=1 58 345 6.0E-27
sp|P75534|GATA_MYCPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gatA PE=3 SV=1 116 296 2.0E-26
sp|B8J405|GATA_DESDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=gatA PE=3 SV=1 59 559 2.0E-26
sp|Q97FQ7|GATA1_CLOAB Glutamyl-tRNA(Gln) amidotransferase subunit A 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatA1 PE=3 SV=1 62 360 3.0E-26
sp|Q8THJ1|GATA_METAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gatA PE=3 SV=1 59 303 3.0E-26
sp|Q8AVG9|GATA_XENLA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Xenopus laevis GN=qrsl1 PE=2 SV=1 67 361 3.0E-26
sp|F7A3P2|GATA_ORNAN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ornithorhynchus anatinus GN=QRSL1 PE=3 SV=1 59 361 3.0E-26
sp|C1FLD9|GATA_CLOBJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gatA PE=3 SV=1 55 360 9.0E-26
sp|B9LZ18|GATA_GEODF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=gatA PE=3 SV=1 53 554 1.0E-25
sp|B0WAE3|GATA_CULQU Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Culex quinquefasciatus GN=gatA PE=3 SV=1 58 362 1.0E-25
sp|E2QUD0|GATA_CANLF Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Canis lupus familiaris GN=QRSL1 PE=3 SV=1 59 361 1.0E-25
sp|C3KU97|GATA_CLOB6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gatA PE=3 SV=1 55 360 1.0E-25
sp|B1XJG8|GATA_SYNP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gatA PE=3 SV=1 58 569 1.0E-25
sp|C6E6Z2|GATA_GEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sp. (strain M21) GN=gatA PE=3 SV=1 59 554 1.0E-25
sp|Q46E35|GATA_METBF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gatA PE=3 SV=1 59 567 2.0E-25
sp|B0TDK7|GATA_HELMI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gatA PE=3 SV=1 53 360 2.0E-25
sp|Q0AZZ2|GATA_SYNWW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gatA PE=3 SV=1 55 567 2.0E-25
sp|Q2RGY4|GATA_MOOTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Moorella thermoacetica (strain ATCC 39073) GN=gatA PE=3 SV=1 122 568 3.0E-25
sp|B0K3S3|GATA_THEPX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermoanaerobacter sp. (strain X514) GN=gatA PE=3 SV=1 53 362 3.0E-25
sp|B1L1G9|GATA_CLOBM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gatA PE=3 SV=1 55 360 4.0E-25
sp|B0KBN4|GATA_THEP3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gatA PE=3 SV=1 53 362 5.0E-25
sp|B3QYQ7|GATA_CHLT3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gatA PE=3 SV=1 71 361 5.0E-25
sp|B1WYP3|GATA_CYAA5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain ATCC 51142) GN=gatA PE=3 SV=1 59 362 6.0E-25
sp|B9LER8|GATA_CHLSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=gatA PE=3 SV=1 54 362 1.0E-24
sp|A9WCD8|GATA_CHLAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gatA PE=3 SV=1 54 362 1.0E-24
sp|Q9RTA9|GATA_DEIRA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gatA PE=3 SV=1 59 300 1.0E-24
sp|Q03AC0|GATA_LACC3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus casei (strain ATCC 334) GN=gatA PE=3 SV=1 57 360 1.0E-24
sp|B5ED19|GATA_GEOBB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gatA PE=3 SV=1 59 554 2.0E-24
sp|A7GIK2|GATA_CLOBL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gatA PE=3 SV=1 55 360 2.0E-24
sp|Q49YU4|GATA_STAS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gatA PE=3 SV=1 59 360 2.0E-24
sp|E0VSP9|GATA_PEDHC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Pediculus humanus subsp. corporis GN=gatA PE=3 SV=1 57 361 2.0E-24
sp|Q5F8U8|GATA_NEIG1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gatA PE=3 SV=1 55 361 2.0E-24
sp|B3WD57|GATA_LACCB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus casei (strain BL23) GN=gatA PE=3 SV=1 57 360 2.0E-24
sp|Q9JTZ5|GATA_NEIMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gatA PE=3 SV=1 55 554 2.0E-24
sp|Q3A2K0|GATA_PELCD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gatA PE=3 SV=1 55 562 2.0E-24
sp|Q9JYZ9|GATA_NEIMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup B (strain MC58) GN=gatA PE=3 SV=1 55 361 2.0E-24
sp|Q9H0R6|GATA_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Homo sapiens GN=QRSL1 PE=1 SV=2 59 361 4.0E-24
sp|A9M003|GATA_NEIM0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup C (strain 053442) GN=gatA PE=3 SV=1 55 361 5.0E-24
sp|Q99YC0|GATA_STRP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M1 GN=gatA PE=3 SV=1 59 360 6.0E-24
sp|A1KUH8|GATA_NEIMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gatA PE=3 SV=1 55 361 6.0E-24
sp|C6BSE9|GATA_DESAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=gatA PE=3 SV=1 55 369 7.0E-24
sp|B4RM85|GATA_NEIG2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gatA PE=3 SV=1 55 361 7.0E-24
sp|Q3AD36|GATA_CARHZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gatA PE=3 SV=1 61 359 7.0E-24
sp|A7IMA7|GATA_XANP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gatA PE=3 SV=1 54 571 9.0E-24
sp|Q313S5|GATA_DESAG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio alaskensis (strain G20) GN=gatA PE=3 SV=1 59 372 9.0E-24
sp|C0M7E8|GATA_STRE4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. equi (strain 4047) GN=gatA PE=3 SV=1 59 360 9.0E-24
sp|A6VWN0|GATA_MARMS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Marinomonas sp. (strain MWYL1) GN=gatA PE=3 SV=1 57 547 2.0E-23
sp|B1INF7|GATA_CLOBK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Okra / Type B1) GN=gatA PE=3 SV=1 55 360 2.0E-23
sp|B4U197|GATA_STREM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gatA PE=3 SV=1 59 360 2.0E-23
sp|A5I6Z3|GATA_CLOBH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gatA PE=3 SV=1 55 360 2.0E-23
sp|A7FYL3|GATA_CLOB1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gatA PE=3 SV=1 55 360 2.0E-23
sp|Q17H91|GATA_AEDAE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Aedes aegypti GN=gatA PE=3 SV=1 76 360 2.0E-23
sp|Q4R7R9|GATA_MACFA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Macaca fascicularis GN=QRSL1 PE=2 SV=1 59 361 2.0E-23
sp|Q1JFB9|GATA_STRPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gatA PE=3 SV=1 59 360 3.0E-23
sp|C0ME97|GATA_STRS7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gatA PE=3 SV=1 59 360 3.0E-23
sp|Q29RP9|GATA_BOVIN Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Bos taurus GN=QRSL1 PE=2 SV=1 59 360 4.0E-23
sp|B9DMT8|GATA_STACT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus carnosus (strain TM300) GN=gatA PE=3 SV=1 59 368 4.0E-23
sp|Q8DK65|GATA_THEEB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermosynechococcus elongatus (strain BP-1) GN=gatA PE=3 SV=2 58 361 4.0E-23
sp|O69768|AMID_PSEPU Amidase OS=Pseudomonas putida PE=3 SV=1 55 373 4.0E-23
sp|B9DVG6|GATA_STRU0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gatA PE=3 SV=1 55 360 5.0E-23
sp|B8G974|GATA_CHLAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=gatA PE=3 SV=1 54 361 6.0E-23
sp|Q8NZM0|GATA_STRP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gatA PE=3 SV=1 59 360 6.0E-23
sp|Q48RQ4|GATA_STRPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gatA PE=3 SV=1 59 360 6.0E-23
sp|Q1J569|GATA_STRPF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gatA PE=3 SV=1 59 360 7.0E-23
sp|B5ZMJ0|GATA_RHILW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gatA PE=3 SV=1 54 554 7.0E-23
sp|F1QAJ4|GATA_DANRE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Danio rerio GN=qrsl1 PE=2 SV=1 59 360 7.0E-23
sp|Q5XAC7|GATA_STRP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gatA PE=3 SV=1 59 360 7.0E-23
sp|A6TTJ8|GATA_ALKMQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alkaliphilus metalliredigens (strain QYMF) GN=gatA PE=3 SV=1 53 360 7.0E-23
sp|Q3AKH0|GATA_SYNSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9605) GN=gatA PE=3 SV=1 59 554 7.0E-23
sp|Q9CZN8|GATA_MOUSE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Mus musculus GN=Qrsl1 PE=1 SV=1 59 361 8.0E-23
sp|B7PDC5|GATA_IXOSC Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Ixodes scapularis GN=gatA PE=3 SV=1 59 305 9.0E-23
sp|Q5FWT5|GATA_RAT Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Rattus norvegicus GN=Qrsl1 PE=2 SV=1 59 361 9.0E-23
sp|A2RCV7|GATA_STRPG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gatA PE=3 SV=1 59 360 9.0E-23
sp|B2A5W7|GATA_NATTJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=gatA PE=3 SV=1 53 354 1.0E-22
sp|Q1J0C2|GATA_DEIGD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Deinococcus geothermalis (strain DSM 11300) GN=gatA PE=3 SV=1 92 300 1.0E-22
sp|B8HY89|GATA_CYAP4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gatA PE=3 SV=1 58 360 1.0E-22
sp|Q2GEE7|GATA_NEOSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Neorickettsia sennetsu (strain Miyayama) GN=gatA PE=3 SV=1 55 304 1.0E-22
sp|Q8RC40|GATA_CALS4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gatA PE=3 SV=1 53 362 2.0E-22
sp|A5G9J9|GATA_GEOUR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter uraniireducens (strain Rf4) GN=gatA PE=3 SV=1 53 565 2.0E-22
sp|P0CZ61|GATA_STRPQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gatA PE=3 SV=1 59 360 2.0E-22
sp|P0CZ60|GATA_STRP3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gatA PE=3 SV=1 59 360 2.0E-22
sp|C4ZHB9|GATA_EUBR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=gatA PE=3 SV=1 59 554 2.0E-22
sp|Q8CRU3|GATA_STAES Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gatA PE=3 SV=1 59 360 3.0E-22
sp|Q5HN34|GATA_STAEQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gatA PE=3 SV=1 59 360 3.0E-22
sp|Q7U7F4|GATA_SYNPX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain WH8102) GN=gatA PE=3 SV=1 59 308 3.0E-22
sp|B7K0I2|GATA_CYAP8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cyanothece sp. (strain PCC 8801) GN=gatA PE=3 SV=1 58 570 3.0E-22
sp|A3CLF8|GATA_STRSV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus sanguinis (strain SK36) GN=gatA PE=3 SV=1 59 360 3.0E-22
sp|Q2K939|GATA_RHIEC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gatA PE=3 SV=1 54 554 3.0E-22
sp|B1YM01|GATA_EXIS2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gatA PE=3 SV=1 55 368 3.0E-22
sp|Q113L8|GATA_TRIEI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Trichodesmium erythraeum (strain IMS101) GN=gatA PE=3 SV=1 58 360 3.0E-22
sp|Q7NKF0|GATA_GLOVI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Gloeobacter violaceus (strain PCC 7421) GN=gatA PE=3 SV=1 59 360 3.0E-22
sp|B5XHZ9|GATA_STRPZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gatA PE=3 SV=1 59 360 4.0E-22
sp|Q2LXM9|GATA_SYNAS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophus aciditrophicus (strain SB) GN=gatA PE=3 SV=1 53 567 4.0E-22
sp|Q60CK8|GATA_METCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gatA PE=3 SV=1 55 402 4.0E-22
sp|B8I601|GATA_CLOCE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=gatA PE=3 SV=1 59 360 4.0E-22
sp|Q1GYD3|GATA_METFK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gatA PE=3 SV=1 59 364 5.0E-22
sp|Q1JKC7|GATA_STRPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gatA PE=3 SV=1 59 360 5.0E-22
sp|Q1JA74|GATA_STRPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gatA PE=3 SV=1 59 360 5.0E-22
sp|A5GTM0|GATA_SYNR3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain RCC307) GN=gatA PE=3 SV=1 65 300 6.0E-22
sp|A8FAS0|GATA_BACP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus pumilus (strain SAFR-032) GN=gatA PE=3 SV=1 55 359 7.0E-22
sp|Q6MDF5|GATA_PARUW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Protochlamydia amoebophila (strain UWE25) GN=gatA PE=3 SV=1 62 362 7.0E-22
sp|B8D125|GATA_HALOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gatA PE=3 SV=1 53 554 7.0E-22
sp|P73558|GATA_SYNY3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gatA PE=3 SV=1 60 565 8.0E-22
sp|Q936X2|ATZF_PSESD Allophanate hydrolase OS=Pseudomonas sp. (strain ADP) GN=atzF PE=1 SV=1 102 362 8.0E-22
sp|Q8DSG5|GATA_STRMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gatA PE=3 SV=1 59 360 1.0E-21
sp|Q8UFS8|GATA_AGRFC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gatA PE=3 SV=2 55 554 1.0E-21
sp|A6VBJ8|GATA_PSEA7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain PA7) GN=gatA PE=3 SV=1 55 360 1.0E-21
sp|A8I9X6|GATA_AZOC5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gatA PE=3 SV=1 55 555 1.0E-21
sp|P47345|GATA_MYCGE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gatA PE=3 SV=1 92 386 1.0E-21
sp|B9DWL8|GATA_CLOK1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium kluyveri (strain NBRC 12016) GN=gatA PE=3 SV=1 59 360 1.0E-21
sp|Q8F3A1|GATA_LEPIN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gatA PE=3 SV=1 62 310 1.0E-21
sp|Q9HVT8|GATA_PSEAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gatA PE=1 SV=1 55 360 1.0E-21
sp|Q72SC3|GATA_LEPIC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gatA PE=3 SV=1 62 310 2.0E-21
sp|B1GZD3|GATA_UNCTG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gatA PE=3 SV=1 60 361 2.0E-21
sp|C4Z3J4|GATA_EUBE2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=gatA PE=3 SV=1 55 554 2.0E-21
sp|C4L690|GATA_EXISA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=gatA PE=3 SV=1 60 330 2.0E-21
sp|C0QRF9|GATA_PERMH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=gatA PE=3 SV=1 59 372 2.0E-21
sp|A1ATL3|GATA_PELPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelobacter propionicus (strain DSM 2379) GN=gatA PE=3 SV=1 55 358 3.0E-21
sp|B6U151|GATA_MAIZE Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Zea mays GN=GATA PE=2 SV=1 58 558 3.0E-21
sp|A6U819|GATA_SINMW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sinorhizobium medicae (strain WSM419) GN=gatA PE=3 SV=1 55 554 3.0E-21
sp|Q7VCJ0|GATA_PROMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gatA PE=3 SV=1 59 554 3.0E-21
sp|Q02GV8|GATA_PSEAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gatA PE=3 SV=1 55 360 3.0E-21
sp|B7V023|GATA_PSEA8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas aeruginosa (strain LESB58) GN=gatA PE=3 SV=1 55 360 3.0E-21
sp|Q9LI77|GATA_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GATA PE=2 SV=1 57 302 3.0E-21
sp|B0C269|GATA_ACAM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acaryochloris marina (strain MBIC 11017) GN=gatA PE=3 SV=1 58 360 3.0E-21
sp|Q0VS72|GATA_ALCBS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gatA PE=3 SV=1 55 362 3.0E-21
sp|A8AVE2|GATA_STRGC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gatA PE=3 SV=1 59 360 4.0E-21
sp|A1K1T5|GATA_AZOSB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azoarcus sp. (strain BH72) GN=gatA PE=3 SV=1 58 334 4.0E-21
sp|Q1MHJ5|GATA_RHIL3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gatA PE=3 SV=1 54 554 4.0E-21
sp|Q7QH64|GATA_ANOGA Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Anopheles gambiae GN=gatA PE=3 SV=3 63 360 5.0E-21
sp|Q4L7L4|GATA_STAHJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gatA PE=3 SV=1 59 297 5.0E-21
sp|Q25A68|GATA_ORYSI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. indica GN=GATA PE=3 SV=1 3 558 5.0E-21
sp|Q5HBG3|GATA_EHRRW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia ruminantium (strain Welgevonden) GN=gatA PE=3 SV=1 59 362 6.0E-21
sp|Q5N0K5|GATA_SYNP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gatA PE=3 SV=1 58 329 6.0E-21
sp|Q31LC2|GATA_SYNE7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus elongatus (strain PCC 7942) GN=gatA PE=3 SV=1 58 329 6.0E-21
sp|A9KJ26|GATA_CLOPH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gatA PE=3 SV=1 53 360 7.0E-21
sp|A5WCI2|GATA_PSYWF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter sp. (strain PRwf-1) GN=gatA PE=3 SV=1 55 374 7.0E-21
sp|Q68XL6|GATA_RICTY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gatA PE=3 SV=1 54 364 7.0E-21
sp|O66610|GATA_AQUAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aquifex aeolicus (strain VF5) GN=gatA PE=1 SV=1 55 337 7.0E-21
sp|Q9ZE10|GATA_RICPR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia prowazekii (strain Madrid E) GN=gatA PE=3 SV=1 54 364 7.0E-21
sp|A0LP22|GATA_SYNFM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=gatA PE=3 SV=1 59 567 8.0E-21
sp|Q31F53|GATA_THICR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thiomicrospira crunogena (strain XCL-2) GN=gatA PE=3 SV=1 55 373 9.0E-21
sp|C5Y8Z8|GATA_SORBI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Sorghum bicolor GN=GATA PE=3 SV=1 58 558 9.0E-21
sp|Q74I52|GATA_LACJO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gatA PE=3 SV=1 60 373 9.0E-21
sp|B2TIZ9|GATA_CLOBB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gatA PE=3 SV=1 66 367 9.0E-21
sp|Q1GBF4|GATA_LACDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gatA PE=3 SV=1 59 373 1.0E-20
sp|A1WVR7|GATA_HALHL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gatA PE=3 SV=1 55 370 1.0E-20
sp|C1CCK0|GATA_STRZJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain JJA) GN=gatA PE=3 SV=1 59 360 1.0E-20
sp|Q97SE6|GATA_STRPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gatA PE=1 SV=1 59 360 1.0E-20
sp|Q39ZK0|GATA_GEOMG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gatA PE=3 SV=1 53 554 1.0E-20
sp|Q04DD1|GATA_OENOB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=gatA PE=3 SV=1 60 360 1.0E-20
sp|Q891I1|GATA_CLOTE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium tetani (strain Massachusetts / E88) GN=gatA PE=3 SV=1 88 360 1.0E-20
sp|Q5M312|GATA_STRT2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gatA PE=3 SV=1 59 360 2.0E-20
sp|Q5LYE9|GATA_STRT1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gatA PE=3 SV=1 59 360 2.0E-20
sp|A7GKK3|GATA_BACCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gatA PE=3 SV=1 55 359 2.0E-20
sp|Q820J1|GATA_NITEU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gatA PE=3 SV=1 71 373 2.0E-20
sp|Q2YC91|GATA_NITMU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gatA PE=3 SV=2 58 334 2.0E-20
sp|Q9X0Z9|GATA_THEMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gatA PE=1 SV=1 89 360 2.0E-20
sp|Q2JUM6|GATA_SYNJA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain JA-3-3Ab) GN=gatA PE=3 SV=1 58 362 2.0E-20
sp|Q8YY02|GATA_NOSS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gatA PE=3 SV=1 58 360 2.0E-20
sp|Q3ISR6|GATA_NATPD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gatA PE=3 SV=1 121 553 2.0E-20
sp|Q1IUE4|GATA_KORVE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Koribacter versatilis (strain Ellin345) GN=gatA PE=3 SV=1 59 361 2.0E-20
sp|C5D4K6|GATA_GEOSW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus sp. (strain WCH70) GN=gatA PE=3 SV=1 55 359 3.0E-20
sp|Q0AFP4|GATA_NITEC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosomonas eutropha (strain C91) GN=gatA PE=3 SV=1 71 334 3.0E-20
sp|C0QKZ5|GATA_DESAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=gatA PE=3 SV=1 53 559 3.0E-20
sp|Q98M95|GATA_RHILO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium loti (strain MAFF303099) GN=gatA PE=3 SV=1 55 554 3.0E-20
sp|A6X562|GATA_OCHA4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gatA PE=3 SV=1 54 554 3.0E-20
sp|Q8ES78|GATA_OCEIH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gatA PE=3 SV=1 55 359 3.0E-20
sp|A1AW13|GATA_RUTMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gatA PE=3 SV=1 55 547 3.0E-20
sp|B1I9M8|GATA_STRPI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gatA PE=3 SV=1 59 360 4.0E-20
sp|Q9YB80|GATA_AERPE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gatA PE=3 SV=2 59 556 4.0E-20
sp|Q04BV7|GATA_LACDB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=gatA PE=3 SV=1 59 373 4.0E-20
sp|Q1MPY8|GATA_LAWIP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gatA PE=3 SV=1 59 362 4.0E-20
sp|Q8DR10|GATA_STRR6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gatA PE=3 SV=1 59 360 5.0E-20
sp|B8ZLK1|GATA_STRPJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=gatA PE=3 SV=1 59 360 5.0E-20
sp|Q04M41|GATA_STRP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gatA PE=3 SV=1 59 360 5.0E-20
sp|Q3M6N4|GATA_ANAVT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gatA PE=3 SV=1 58 300 5.0E-20
sp|B1HTW9|GATA_LYSSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lysinibacillus sphaericus (strain C3-41) GN=gatA PE=3 SV=1 55 360 5.0E-20
sp|Q6GFF7|GATA_STAAR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MRSA252) GN=gatA PE=3 SV=1 59 297 5.0E-20
sp|Q73HP2|GATA_WOLPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia pipientis wMel GN=gatA PE=3 SV=1 54 554 6.0E-20
sp|Q2RPH4|GATA_RHORT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gatA PE=3 SV=1 55 361 6.0E-20
sp|Q2SBG5|GATA_HAHCH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Hahella chejuensis (strain KCTC 2396) GN=gatA PE=3 SV=1 59 359 6.0E-20
sp|Q2S4S2|GATA_SALRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gatA PE=3 SV=1 55 360 6.0E-20
sp|Q9RF07|GATA_STAAU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus GN=gatA PE=3 SV=1 59 297 6.0E-20
sp|Q6MRL7|GATA_BDEBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gatA PE=3 SV=1 55 361 7.0E-20
sp|A4WUQ2|GATA_RHOS5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gatA PE=3 SV=1 57 554 8.0E-20
sp|A8Z2R4|GATA_STAAT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gatA PE=3 SV=1 59 297 9.0E-20
sp|A6QIC8|GATA_STAAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Newman) GN=gatA PE=3 SV=1 59 297 9.0E-20
sp|Q5HEM2|GATA_STAAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain COL) GN=gatA PE=3 SV=1 59 297 9.0E-20
sp|Q2FWY9|GATA_STAA8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain NCTC 8325) GN=gatA PE=3 SV=1 59 297 9.0E-20
sp|Q2FFJ5|GATA_STAA3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain USA300) GN=gatA PE=3 SV=1 59 297 9.0E-20
sp|Q050D1|GATA_LEPBL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gatA PE=3 SV=1 62 300 1.0E-19
sp|Q04SA5|GATA_LEPBJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gatA PE=3 SV=1 62 300 1.0E-19
sp|B4UIV1|GATA_ANASK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter sp. (strain K) GN=gatA PE=3 SV=1 67 554 1.0E-19
sp|Q7UT33|GATA_RHOBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gatA PE=3 SV=1 67 300 1.0E-19
sp|Q5FHN7|GATA_EHRRG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia ruminantium (strain Gardel) GN=gatA PE=3 SV=2 59 362 1.0E-19
sp|Q6G3E9|GATA_BARHE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gatA PE=3 SV=1 55 362 1.0E-19
sp|Q65MP8|GATA_BACLD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gatA PE=3 SV=1 55 359 1.0E-19
sp|Q7X8Z8|GATA_ORYSJ Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=GATA PE=3 SV=3 3 558 1.0E-19
sp|Q041K5|GATA_LACGA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gatA PE=3 SV=1 60 373 1.0E-19
sp|Q8NVT3|GATA_STAAW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MW2) GN=gatA PE=3 SV=1 59 297 2.0E-19
sp|Q6G833|GATA_STAAS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain MSSA476) GN=gatA PE=3 SV=1 59 297 2.0E-19
sp|A5IU67|GATA_STAA9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain JH9) GN=gatA PE=3 SV=1 59 297 2.0E-19
sp|A6U305|GATA_STAA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain JH1) GN=gatA PE=3 SV=1 59 297 2.0E-19
sp|C1C5H2|GATA_STRP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain 70585) GN=gatA PE=3 SV=1 59 360 2.0E-19
sp|C1CIT8|GATA_STRZP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain P1031) GN=gatA PE=3 SV=1 59 360 2.0E-19
sp|B5E1P7|GATA_STRP4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gatA PE=3 SV=1 59 360 2.0E-19
sp|C1CPU7|GATA_STRZT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=gatA PE=3 SV=1 59 360 2.0E-19
sp|A0RU64|GATA_CENSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cenarchaeum symbiosum (strain A) GN=gatA PE=3 SV=1 55 303 2.0E-19
sp|Q0SNH0|GATA_BORAP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia afzelii (strain PKo) GN=gatA PE=3 SV=1 55 297 2.0E-19
sp|Q2JL51|GATA_SYNJB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gatA PE=3 SV=1 58 362 2.0E-19
sp|A5EY31|GATA_DICNV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dichelobacter nodosus (strain VCS1703A) GN=gatA PE=3 SV=1 55 374 2.0E-19
sp|Q746Y7|GATA_GEOSL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gatA PE=3 SV=1 53 565 2.0E-19
sp|A9VRH7|GATA_BACWK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus weihenstephanensis (strain KBAB4) GN=gatA PE=3 SV=1 55 359 2.0E-19
sp|B8FCK9|GATA_DESAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfatibacillum alkenivorans (strain AK-01) GN=gatA PE=3 SV=1 55 334 2.0E-19
sp|B2ILX8|GATA_STRPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae (strain CGSP14) GN=gatA PE=3 SV=1 59 360 2.0E-19
sp|B7H4W2|GATA_BACC4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain B4264) GN=gatA PE=3 SV=1 55 359 2.0E-19
sp|B7IUX9|GATA_BACC2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain G9842) GN=gatA PE=3 SV=1 55 359 2.0E-19
sp|Q81IN3|GATA_BACCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gatA PE=3 SV=1 55 359 3.0E-19
sp|B3EA24|GATA_GEOLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gatA PE=3 SV=1 53 554 3.0E-19
sp|Q4KIA8|GATA_PSEF5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gatA PE=3 SV=1 55 373 3.0E-19
sp|Q661S5|GATA_BORBP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gatA PE=3 SV=1 55 297 3.0E-19
sp|B2UZ26|GATA_CLOBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gatA PE=3 SV=1 61 367 3.0E-19
sp|A5ICP2|GATA_LEGPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Corby) GN=gatA PE=3 SV=1 55 361 3.0E-19
sp|Q5L3B3|GATA_GEOKA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus kaustophilus (strain HTA426) GN=gatA PE=3 SV=1 55 358 3.0E-19
sp|A4J6Z8|GATA_DESRM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfotomaculum reducens (strain MI-1) GN=gatA PE=3 SV=1 55 568 3.0E-19
sp|B9J1N0|GATA_BACCQ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain Q1) GN=gatA PE=3 SV=1 55 554 4.0E-19
sp|B3DWT4|GATA_METI4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylacidiphilum infernorum (isolate V4) GN=gatA PE=3 SV=1 53 360 4.0E-19
sp|A9B9W7|GATA_PROM4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9211) GN=gatA PE=3 SV=1 59 554 4.0E-19
sp|Q84DC4|MANHY_PSEPU Mandelamide hydrolase OS=Pseudomonas putida GN=mdlY PE=1 SV=1 57 289 4.0E-19
sp|B7HSY0|GATA_BACC7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain AH187) GN=gatA PE=3 SV=1 55 359 4.0E-19
sp|Q73EK8|GATA_BACC1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gatA PE=3 SV=1 55 359 4.0E-19
sp|Q63GR0|GATA_BACCZ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain ZK / E33L) GN=gatA PE=3 SV=1 55 359 4.0E-19
sp|Q6HP81|GATA_BACHK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gatA PE=3 SV=1 55 554 4.0E-19
sp|C1EV88|GATA_BACC3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain 03BB102) GN=gatA PE=3 SV=1 55 554 4.0E-19
sp|A0R921|GATA_BACAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus thuringiensis (strain Al Hakam) GN=gatA PE=3 SV=1 55 554 4.0E-19
sp|B8JBQ1|GATA_ANAD2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=gatA PE=3 SV=1 67 554 4.0E-19
sp|B7JMB2|GATA_BACC0 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus cereus (strain AH820) GN=gatA PE=3 SV=1 55 359 5.0E-19
sp|Q81ZE8|GATA_BACAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis GN=gatA PE=3 SV=1 55 359 5.0E-19
sp|C3L559|GATA_BACAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gatA PE=3 SV=1 55 359 5.0E-19
sp|C3PBQ4|GATA_BACAA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus anthracis (strain A0248) GN=gatA PE=3 SV=1 55 359 5.0E-19
sp|Q49091|GATA_MORCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Moraxella catarrhalis GN=gatA PE=3 SV=1 55 368 5.0E-19
sp|Q5X4H5|GATA_LEGPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Paris) GN=gatA PE=3 SV=1 55 361 6.0E-19
sp|Q03Q16|GATA_LACBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=gatA PE=3 SV=1 53 346 7.0E-19
sp|P9WQ93|AMI4_MYCTU Putative amidase AmiD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=amiD PE=1 SV=1 54 362 7.0E-19
sp|P9WQ92|AMI4_MYCTO Putative amidase AmiD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=amiD PE=3 SV=1 54 362 7.0E-19
sp|P63497|AMI4_MYCBO Putative amidase AmiD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=amiD PE=3 SV=1 54 362 7.0E-19
sp|A5VUS6|GATA_BRUO2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gatA PE=3 SV=1 54 554 7.0E-19
sp|A4IJZ2|GATA_GEOTN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gatA PE=3 SV=1 55 359 7.0E-19
sp|E0CTY1|GATA_VITVI Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Vitis vinifera GN=GATA PE=3 SV=1 57 367 8.0E-19
sp|A0LSR0|GATA_ACIC1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=gatA PE=3 SV=1 59 309 8.0E-19
sp|Q72DX1|GATA_DESVH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gatA PE=3 SV=1 55 362 8.0E-19
sp|A5CX65|GATA_VESOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gatA PE=3 SV=1 55 368 8.0E-19
sp|Q2YU51|GATA_STAAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gatA PE=3 SV=1 59 297 8.0E-19
sp|A8F5H6|GATA_PSELT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gatA PE=3 SV=1 116 360 9.0E-19
sp|A1VFG9|GATA_DESVV Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gatA PE=3 SV=1 55 362 9.0E-19
sp|C4K0R4|GATA_RICPU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia peacockii (strain Rustic) GN=gatA PE=3 SV=1 54 364 9.0E-19
sp|B2IYD7|GATA_NOSP7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gatA PE=3 SV=1 58 300 9.0E-19
sp|A9IU58|GATA_BART1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gatA PE=3 SV=1 55 360 9.0E-19
sp|P63489|GATA_STAAN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain N315) GN=gatA PE=1 SV=1 59 297 1.0E-18
sp|P63488|GATA_STAAM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gatA PE=1 SV=1 59 297 1.0E-18
sp|A7X427|GATA_STAA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gatA PE=3 SV=1 59 297 1.0E-18
sp|A8GQX7|GATA_RICRS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia rickettsii (strain Sheila Smith) GN=gatA PE=3 SV=1 54 364 1.0E-18
sp|B0BWC3|GATA_RICRO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia rickettsii (strain Iowa) GN=gatA PE=3 SV=1 54 364 1.0E-18
sp|Q6A8P5|GATA_PROAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gatA PE=3 SV=1 59 362 1.0E-18
sp|C0RLB5|GATA_BRUMB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gatA PE=3 SV=1 54 554 1.0E-18
sp|B9E826|GATA_MACCJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Macrococcus caseolyticus (strain JCSC5402) GN=gatA PE=3 SV=1 55 360 1.0E-18
sp|O51317|GATA_BORBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gatA PE=3 SV=2 55 297 1.0E-18
sp|Q8YC57|GATA_BRUME Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gatA PE=3 SV=2 54 554 1.0E-18
sp|C0R5M6|GATA_WOLWR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=gatA PE=3 SV=1 54 299 1.0E-18
sp|Q92J75|GATA_RICCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gatA PE=3 SV=1 54 364 2.0E-18
sp|C3PMJ0|GATA_RICAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia africae (strain ESF-5) GN=gatA PE=3 SV=1 54 364 2.0E-18
sp|Q87WR9|GATA_PSESM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gatA PE=3 SV=1 55 368 2.0E-18
sp|Q93LE2|GATA_GEOSE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Geobacillus stearothermophilus GN=gatA PE=3 SV=1 55 359 2.0E-18
sp|A9MBN4|GATA_BRUC2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gatA PE=3 SV=1 54 554 2.0E-18
sp|C3MAA3|GATA_RHISN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium sp. (strain NGR234) GN=gatA PE=3 SV=1 55 554 2.0E-18
sp|B0T193|GATA_CAUSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter sp. (strain K31) GN=gatA PE=3 SV=1 55 361 2.0E-18
sp|Q9CJ43|GATA_LACLA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gatA PE=3 SV=1 59 360 2.0E-18
sp|Q0I9N6|GATA_SYNS3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9311) GN=gatA PE=3 SV=1 60 362 2.0E-18
sp|B2T1M4|GATA_BURPP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gatA PE=3 SV=1 55 362 3.0E-18
sp|Q03J81|GATA_STRTD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gatA PE=3 SV=1 59 360 3.0E-18
sp|Q48E92|GATA_PSE14 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gatA PE=3 SV=1 55 368 3.0E-18
sp|B7GFW3|GATA_ANOFW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=gatA PE=3 SV=1 60 359 3.0E-18
sp|A9WYR3|GATA_BRUSI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gatA PE=3 SV=1 54 554 4.0E-18
sp|A5UXF9|GATA_ROSS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseiflexus sp. (strain RS-1) GN=gatA PE=3 SV=1 55 554 4.0E-18
sp|Q5WVW0|GATA_LEGPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Lens) GN=gatA PE=3 SV=1 55 361 4.0E-18
sp|Q5GRM3|GATA_WOLTR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gatA PE=3 SV=2 54 297 5.0E-18
sp|Q4UKF1|GATA_RICFE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gatA PE=3 SV=1 54 364 5.0E-18
sp|Q2J6U6|GATA_FRASC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Frankia sp. (strain CcI3) GN=gatA PE=3 SV=1 70 300 5.0E-18
sp|Q577Z3|GATA_BRUAB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus biovar 1 (strain 9-941) GN=gatA PE=3 SV=1 54 554 5.0E-18
sp|Q2YKL3|GATA_BRUA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus (strain 2308) GN=gatA PE=3 SV=1 54 554 5.0E-18
sp|B2SB62|GATA_BRUA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella abortus (strain S19) GN=gatA PE=3 SV=1 54 554 5.0E-18
sp|Q9Z9W9|GATA_BACHD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gatA PE=3 SV=1 55 359 5.0E-18
sp|C3K6Y4|GATA_PSEFS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain SBW25) GN=gatA PE=3 SV=1 55 373 5.0E-18
sp|A0AJK8|GATA_LISW6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gatA PE=3 SV=1 55 359 6.0E-18
sp|B0SRP1|GATA_LEPBP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gatA PE=3 SV=1 59 299 7.0E-18
sp|B0S8V3|GATA_LEPBA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gatA PE=3 SV=1 59 299 7.0E-18
sp|Q837V3|GATA_ENTFA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gatA PE=3 SV=1 54 296 7.0E-18
sp|Q8FW67|GATA_BRUSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brucella suis biovar 1 (strain 1330) GN=gatA PE=3 SV=1 54 554 7.0E-18
sp|Q146Y5|GATA_BURXL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia xenovorans (strain LB400) GN=gatA PE=3 SV=1 55 361 9.0E-18
sp|A5GKM7|GATA_SYNPW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain WH7803) GN=gatA PE=3 SV=1 60 334 9.0E-18
sp|Q5FLL1|GATA_LACAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gatA PE=3 SV=1 60 366 9.0E-18
sp|O06491|GATA_BACSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus subtilis (strain 168) GN=gatA PE=3 SV=3 108 359 9.0E-18
sp|Q4ZNS7|GATA_PSEU2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gatA PE=3 SV=1 55 368 1.0E-17
sp|A7Z267|GATA_BACMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gatA PE=3 SV=1 55 359 1.0E-17
sp|B9JVJ1|GATA_AGRVS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gatA PE=3 SV=1 54 554 1.0E-17
sp|Q38VC9|GATA_LACSS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gatA PE=3 SV=1 60 297 1.0E-17
sp|A8YTZ6|GATA_LACH4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus helveticus (strain DPC 4571) GN=gatA PE=3 SV=1 60 378 1.0E-17
sp|A4X490|GATA_SALTO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=gatA PE=3 SV=1 70 362 1.0E-17
sp|A2CA16|GATA_PROM3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9303) GN=gatA PE=3 SV=1 60 361 1.0E-17
sp|Q0BTK2|GATA_GRABC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gatA PE=3 SV=1 55 554 1.0E-17
sp|Q5ZUQ7|GATA_LEGPH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gatA PE=3 SV=1 55 361 1.0E-17
sp|A8ZSP8|GATA_DESOH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=gatA PE=3 SV=1 59 303 2.0E-17
sp|C0Z4E4|GATA_BREBN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=gatA PE=3 SV=1 55 359 2.0E-17
sp|Q9Z580|GATA_STRCO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gatA PE=3 SV=1 59 300 2.0E-17
sp|B2GDS6|GATA_LACF3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=gatA PE=3 SV=1 60 360 2.0E-17
sp|B3CMT8|GATA_WOLPP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gatA PE=3 SV=1 54 297 2.0E-17
sp|A4XQK6|GATA_PSEMY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas mendocina (strain ymp) GN=gatA PE=3 SV=1 55 360 2.0E-17
sp|A8EXM1|GATA_RICCK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia canadensis (strain McKiel) GN=gatA PE=3 SV=1 54 364 2.0E-17
sp|A8GMC0|GATA_RICAH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia akari (strain Hartford) GN=gatA PE=3 SV=1 54 362 2.0E-17
sp|A9WPN2|GATA_RENSM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=gatA PE=3 SV=1 70 300 3.0E-17
sp|Q2W6Y6|GATA_MAGSA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gatA PE=3 SV=2 54 300 3.0E-17
sp|Q4J965|GATA_SULAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gatA PE=3 SV=1 60 329 3.0E-17
sp|Q1DCA3|GATA_MYXXD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Myxococcus xanthus (strain DK 1622) GN=gatA PE=3 SV=1 53 362 3.0E-17
sp|Q5V2G6|GATA_HALMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gatA PE=3 SV=1 121 352 3.0E-17
sp|Q5HU43|GATA_CAMJR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Campylobacter jejuni (strain RM1221) GN=gatA PE=3 SV=1 119 361 3.0E-17
sp|Q9A5L0|GATA_CAUCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gatA PE=3 SV=1 53 362 4.0E-17
sp|B8GZJ5|GATA_CAUCN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gatA PE=3 SV=1 53 362 4.0E-17
sp|Q2GGC5|GATA_EHRCR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gatA PE=3 SV=1 59 297 4.0E-17
sp|C1DQ37|GATA_AZOVD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=gatA PE=3 SV=1 55 360 4.0E-17
sp|Q5FND3|GATA_GLUOX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Gluconobacter oxydans (strain 621H) GN=gatA PE=3 SV=1 55 554 4.0E-17
sp|B7GTU6|GATA_BIFLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gatA PE=3 SV=1 66 302 4.0E-17
sp|Q3YSB0|GATA_EHRCJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ehrlichia canis (strain Jake) GN=gatA PE=3 SV=2 59 554 4.0E-17
sp|Q92AQ3|GATA_LISIN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gatA PE=3 SV=1 55 359 4.0E-17
sp|Q47JV4|GATA_DECAR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Dechloromonas aromatica (strain RCB) GN=gatA PE=3 SV=1 58 372 5.0E-17
sp|Q8Y3C3|GATA_RALSO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ralstonia solanacearum (strain GMI1000) GN=gatA PE=3 SV=1 55 362 5.0E-17
sp|Q8G768|GATA_BIFLO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum (strain NCC 2705) GN=gatA PE=3 SV=1 66 302 5.0E-17
sp|B3DU32|GATA_BIFLD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bifidobacterium longum (strain DJO10A) GN=gatA PE=3 SV=1 66 302 5.0E-17
sp|Q2G4F5|GATA_NOVAD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gatA PE=3 SV=1 55 300 5.0E-17
sp|Q71YR3|GATA_LISMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gatA PE=3 SV=1 55 359 6.0E-17
sp|C1KW54|GATA_LISMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gatA PE=3 SV=1 55 359 6.0E-17
sp|Q1WSH9|GATA_LACS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus salivarius (strain UCC118) GN=gatA PE=3 SV=1 53 554 6.0E-17
sp|Q58560|GATA_METJA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gatA PE=3 SV=1 75 361 6.0E-17
sp|A4VT83|GATA_STRSY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus suis (strain 05ZYH33) GN=gatA PE=3 SV=1 59 360 6.0E-17
sp|A4VZG5|GATA_STRS2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus suis (strain 98HAH33) GN=gatA PE=3 SV=1 59 360 6.0E-17
sp|B1ZLM1|GATA_METPB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gatA PE=3 SV=1 55 360 6.0E-17
sp|Q5LP80|GATA_RUEPO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gatA PE=3 SV=1 55 554 6.0E-17
sp|A6W7L7|GATA_KINRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=gatA PE=3 SV=1 62 329 7.0E-17
sp|O27955|GATA_ARCFU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatA PE=3 SV=1 75 310 7.0E-17
sp|Q8Y6D2|GATA_LISMO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gatA PE=3 SV=1 55 359 7.0E-17
sp|Q3KI27|GATA_PSEPF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas fluorescens (strain Pf0-1) GN=gatA PE=3 SV=1 55 373 8.0E-17
sp|Q47860|HYIN_PANAY Indoleacetamide hydrolase OS=Pantoea agglomerans pv. gypsophilae GN=iaaH PE=3 SV=1 95 361 8.0E-17
sp|Q5YRT4|GATA_NOCFA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nocardia farcinica (strain IFM 10152) GN=gatA PE=3 SV=1 55 554 8.0E-17
sp|Q6FZS9|GATA_BARQU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella quintana (strain Toulouse) GN=gatA PE=3 SV=1 55 362 9.0E-17
sp|B9KPF8|GATA_RHOSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gatA PE=3 SV=1 57 554 9.0E-17
sp|Q82JL0|GATA_STRAW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gatA PE=3 SV=1 59 300 9.0E-17
sp|A2RHP5|GATA_LACLM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gatA PE=3 SV=1 59 360 1.0E-16
sp|Q5P4D0|GATA_AROAE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Aromatoleum aromaticum (strain EbN1) GN=gatA PE=3 SV=1 58 300 1.0E-16
sp|B4S4W1|GATA_PROA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gatA PE=3 SV=1 55 404 1.0E-16
sp|A7H2U1|GATA_CAMJD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=gatA PE=3 SV=1 119 361 1.0E-16
sp|A8FMB2|GATA_CAMJ8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=gatA PE=3 SV=1 119 361 1.0E-16
sp|A1W048|GATA_CAMJJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=gatA PE=3 SV=1 119 361 1.0E-16
sp|Q9PNN2|GATA_CAMJE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gatA PE=3 SV=1 119 361 1.0E-16
sp|Q28T24|GATA_JANSC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Jannaschia sp. (strain CCS1) GN=gatA PE=3 SV=1 55 360 1.0E-16
sp|B8EPC1|GATA_METSB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gatA PE=3 SV=1 55 569 1.0E-16
sp|O59805|YJV7_SCHPO Putative amidase C550.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.07 PE=3 SV=1 46 281 1.0E-16
sp|B0KQG0|GATA_PSEPG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain GB-1) GN=gatA PE=3 SV=1 55 373 1.0E-16
sp|Q6AEE8|GATA_LEIXX Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=gatA PE=3 SV=1 70 300 1.0E-16
sp|A9W748|GATA_METEP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium extorquens (strain PA1) GN=gatA PE=3 SV=1 55 300 1.0E-16
sp|A7NKM0|GATA_ROSCS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=gatA PE=3 SV=1 55 570 2.0E-16
sp|Q1GFB5|GATA_RUEST Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Ruegeria sp. (strain TM1040) GN=gatA PE=3 SV=1 55 300 2.0E-16
sp|Q5PAL2|GATA_ANAMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaplasma marginale (strain St. Maries) GN=gatA PE=3 SV=1 54 297 2.0E-16
sp|B9KIR2|GATA_ANAMF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaplasma marginale (strain Florida) GN=gatA PE=3 SV=1 54 297 2.0E-16
sp|Q3J7V7|GATA_NITOC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gatA PE=3 SV=1 55 334 2.0E-16
sp|C0R074|GATA_BRAHW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gatA PE=3 SV=1 53 362 2.0E-16
sp|A8M5E6|GATA_SALAI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Salinispora arenicola (strain CNS-205) GN=gatA PE=3 SV=1 122 329 2.0E-16
sp|Q8KFQ4|GATA_CHLTE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gatA PE=3 SV=1 61 361 3.0E-16
sp|Q8E3P4|GATA_STRA3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gatA PE=3 SV=1 59 310 3.0E-16
sp|Q8DY25|GATA_STRA5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gatA PE=3 SV=1 59 360 3.0E-16
sp|Q3JZM1|GATA_STRA1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gatA PE=3 SV=1 59 360 3.0E-16
sp|Q032T3|GATA_LACLS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gatA PE=3 SV=1 59 360 3.0E-16
sp|Q5WJ20|GATA_BACSK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus clausii (strain KSM-K16) GN=gatA PE=3 SV=1 55 359 3.0E-16
sp|A9AC51|GATA_BURM1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gatA PE=3 SV=1 55 361 3.0E-16
sp|Q0ACB5|GATA_ALKEH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gatA PE=3 SV=1 55 360 3.0E-16
sp|B0VS13|GATA_ACIBS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain SDF) GN=gatA PE=3 SV=1 55 373 4.0E-16
sp|B8DFG8|GATA_LISMH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gatA PE=3 SV=1 55 359 4.0E-16
sp|Q2IH94|GATA_ANADE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gatA PE=3 SV=1 67 362 4.0E-16
sp|Q72L58|GATA_THET2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gatA PE=3 SV=1 61 300 4.0E-16
sp|Q92QK7|GATA_RHIME Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhizobium meliloti (strain 1021) GN=gatA PE=3 SV=1 55 554 4.0E-16
sp|A1UT20|GATA_BARBK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gatA PE=3 SV=1 55 362 4.0E-16
sp|B5YL59|GATA_THEYD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gatA PE=3 SV=1 53 554 4.0E-16
sp|Q83BM9|GATA_COXBU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gatA PE=3 SV=1 55 361 5.0E-16
sp|A9N8Z4|GATA_COXBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gatA PE=3 SV=1 55 361 5.0E-16
sp|A9KBI0|GATA_COXBN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gatA PE=3 SV=1 55 361 5.0E-16
sp|B6IZ25|GATA_COXB2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain CbuG_Q212) GN=gatA PE=3 SV=1 55 361 5.0E-16
sp|B6J4H5|GATA_COXB1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Coxiella burnetii (strain CbuK_Q154) GN=gatA PE=3 SV=1 55 361 5.0E-16
sp|C5BSY8|GATA_TERTT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gatA PE=3 SV=1 55 372 5.0E-16
sp|Q88PB9|GATA_PSEPK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain KT2440) GN=gatA PE=3 SV=1 55 373 5.0E-16
sp|Q1QDJ4|GATA_PSYCK Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter cryohalolentis (strain K5) GN=gatA PE=3 SV=1 54 374 5.0E-16
sp|B7KWB0|GATA_METC4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gatA PE=3 SV=1 55 300 5.0E-16
sp|Q3SM39|GATA_THIDA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gatA PE=3 SV=1 71 372 6.0E-16
sp|B2IEA4|GATA_BEII9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gatA PE=3 SV=1 54 554 6.0E-16
sp|B0VEN3|GATA_ACIBY Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AYE) GN=gatA PE=3 SV=1 55 373 6.0E-16
sp|B2HY00|GATA_ACIBC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain ACICU) GN=gatA PE=3 SV=1 55 373 6.0E-16
sp|B7GXC5|GATA_ACIB3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AB307-0294) GN=gatA PE=3 SV=1 55 373 6.0E-16
sp|Q7NPY7|GATA_CHRVO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gatA PE=3 SV=1 55 370 6.0E-16
sp|B1JDP1|GATA_PSEPW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain W619) GN=gatA PE=3 SV=1 55 373 6.0E-16
sp|Q1IED3|GATA_PSEE4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas entomophila (strain L48) GN=gatA PE=3 SV=1 55 374 6.0E-16
sp|A3PI90|GATA_RHOS1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gatA PE=3 SV=1 57 554 6.0E-16
sp|A4FW11|GATA_METM5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gatA PE=3 SV=1 85 362 6.0E-16
sp|A4JIT0|GATA_BURVG Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gatA PE=3 SV=1 55 361 7.0E-16
sp|Q4FLQ7|GATA_PELUB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pelagibacter ubique (strain HTCC1062) GN=gatA PE=3 SV=1 59 558 8.0E-16
sp|Q5AK64|GATA_CANAL Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HER2 PE=3 SV=1 123 330 8.0E-16
sp|B8GL95|GATA_THISH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gatA PE=3 SV=1 55 360 8.0E-16
sp|C1F857|GATA_ACIC5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gatA PE=3 SV=1 92 360 8.0E-16
sp|Q7V7T6|GATA_PROMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Prochlorococcus marinus (strain MIT 9313) GN=gatA PE=3 SV=1 60 300 8.0E-16
sp|B7I7N2|GATA_ACIB5 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain AB0057) GN=gatA PE=3 SV=1 55 373 9.0E-16
sp|C4YRY0|GATA_CANAW Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Candida albicans (strain WO-1) GN=HER2 PE=3 SV=1 123 330 9.0E-16
sp|Q7VIA7|GATA_HELHP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gatA PE=3 SV=1 127 364 9.0E-16
sp|A6VH97|GATA_METM7 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gatA PE=3 SV=1 92 362 1.0E-15
sp|Q4FUG4|GATA_PSYA2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gatA PE=3 SV=1 54 374 1.0E-15
sp|A4SGD2|GATA_CHLPM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gatA PE=3 SV=1 55 374 1.0E-15
sp|Q9LCX3|GATA_THET8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gatA PE=1 SV=2 61 300 1.0E-15
sp|Q3J459|GATA_RHOS4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gatA PE=3 SV=1 57 554 1.0E-15
sp|Q1GUW3|GATA_SPHAL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=gatA PE=3 SV=1 54 361 1.0E-15
sp|A5VZ22|GATA_PSEP1 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gatA PE=3 SV=1 55 373 2.0E-15
sp|Q3ATD7|GATA_CHLCH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlorobium chlorochromatii (strain CaD3) GN=gatA PE=3 SV=1 55 364 2.0E-15
sp|P0A2X0|HYIN_RHIRD Indoleacetamide hydrolase OS=Rhizobium radiobacter GN=tms2 PE=3 SV=1 59 361 2.0E-15
sp|P0A2X2|HYIN_AGRT9 Indoleacetamide hydrolase OS=Agrobacterium tumefaciens (strain 15955) GN=tms2 PE=3 SV=1 59 361 2.0E-15
sp|P0A2X1|HYIN_AGRT4 Indoleacetamide hydrolase OS=Agrobacterium tumefaciens (strain Ach5) GN=tms2 PE=3 SV=1 59 361 2.0E-15
sp|Q2T293|GATA_BURTA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gatA PE=3 SV=1 55 361 2.0E-15
sp|Q11IL4|GATA_CHESB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chelativorans sp. (strain BNC1) GN=gatA PE=3 SV=1 54 554 2.0E-15
sp|Q1LSE1|GATA_CUPMC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gatA PE=3 SV=1 59 364 2.0E-15
sp|A5CEC8|GATA_ORITB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Orientia tsutsugamushi (strain Boryong) GN=gatA PE=3 SV=1 55 331 2.0E-15
sp|Q04557|HYIN1_AGRVS Indoleacetamide hydrolase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=iaaH PE=3 SV=1 55 317 2.0E-15
sp|P25016|HYIN2_AGRVI Indoleacetamide hydrolase OS=Agrobacterium vitis GN=TA-iaaH PE=3 SV=1 125 370 2.0E-15
sp|B2G8T6|GATA_LACRJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus reuteri (strain JCM 1112) GN=gatA PE=3 SV=1 57 360 2.0E-15
sp|A5VLG3|GATA_LACRD Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Lactobacillus reuteri (strain DSM 20016) GN=gatA PE=3 SV=1 57 360 2.0E-15
sp|A3M8F1|GATA_ACIBT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=gatA PE=3 SV=2 55 373 2.0E-15
sp|Q83HX2|GATA_TROW8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Tropheryma whipplei (strain TW08/27) GN=gatA PE=3 SV=2 55 566 3.0E-15
sp|Q3AVK4|GATA_SYNS9 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Synechococcus sp. (strain CC9902) GN=gatA PE=3 SV=1 59 300 3.0E-15
sp|B2UMP4|GATA_AKKM8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=gatA PE=3 SV=1 57 374 3.0E-15
sp|A5EKP4|GATA_BRASB Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gatA PE=3 SV=1 55 330 3.0E-15
sp|Q253Q1|GATA_CHLFF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Chlamydophila felis (strain Fe/C-56) GN=gatA PE=3 SV=1 62 299 4.0E-15
sp|Q0ANY9|GATA_MARMM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Maricaulis maris (strain MCS10) GN=gatA PE=3 SV=1 53 300 4.0E-15
sp|Q6LX43|GATA_METMP Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain S2 / LL) GN=gatA PE=3 SV=1 92 362 5.0E-15
sp|Q83GA1|GATA_TROWT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Tropheryma whipplei (strain Twist) GN=gatA PE=3 SV=1 55 566 5.0E-15
sp|Q1RHE9|GATA_RICBR Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia bellii (strain RML369-C) GN=gatA PE=3 SV=1 54 362 5.0E-15
sp|A8GV46|GATA_RICB8 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rickettsia bellii (strain OSU 85-389) GN=gatA PE=3 SV=1 54 362 6.0E-15
sp|A5V3V0|GATA_SPHWW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gatA PE=3 SV=1 63 554 6.0E-15
sp|Q5NPF3|GATA_ZYMMO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gatA PE=3 SV=1 54 362 6.0E-15
sp|Q89K29|GATA_BRADU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gatA PE=3 SV=1 55 300 6.0E-15
sp|B0TWN0|GATA_FRAP2 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gatA PE=3 SV=1 60 310 6.0E-15
sp|Q39BW3|GATA_BURL3 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gatA PE=3 SV=1 55 361 6.0E-15
sp|Q0BK40|GATA_FRATO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gatA PE=3 SV=1 60 310 7.0E-15
sp|Q2A1D8|GATA_FRATH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gatA PE=3 SV=1 60 310 7.0E-15
sp|A7NEM1|GATA_FRATF Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gatA PE=3 SV=1 60 310 7.0E-15
sp|Q97ZG1|GATA_SULSO Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gatA-2 PE=3 SV=1 81 370 7.0E-15
sp|A4IVY3|GATA_FRATW Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gatA PE=3 SV=1 60 310 8.0E-15
sp|B3CQQ9|GATA_ORITI Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Orientia tsutsugamushi (strain Ikeda) GN=gatA PE=3 SV=1 55 361 9.0E-15
sp|A7I1S8|GATA_CAMHC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=gatA PE=3 SV=1 107 361 9.0E-15
sp|B1YPV8|GATA_BURA4 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia ambifaria (strain MC40-6) GN=gatA PE=3 SV=1 55 361 1.0E-14
sp|Q21RH9|GATA_RHOFT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gatA PE=3 SV=1 55 361 1.0E-14
sp|Q9FR37|AMI1_ARATH Amidase 1 OS=Arabidopsis thaliana GN=AMI1 PE=1 SV=1 125 277 1.0E-14
sp|B2S4Q7|GATA_TREPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gatA PE=3 SV=1 58 297 1.0E-14
sp|O83983|GATA_TREPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Treponema pallidum (strain Nichols) GN=gatA PE=3 SV=1 58 297 1.0E-14
sp|A0KBH9|GATA_BURCH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia cenocepacia (strain HI2424) GN=gatA PE=3 SV=1 55 361 1.0E-14
sp|B1K0H7|GATA_BURCC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia cenocepacia (strain MC0-3) GN=gatA PE=3 SV=1 55 361 1.0E-14
sp|Q1BSL2|GATA_BURCA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia cenocepacia (strain AU 1054) GN=gatA PE=3 SV=1 55 361 1.0E-14
sp|B4E7X6|GATA_BURCJ Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gatA PE=3 SV=1 55 361 1.0E-14
sp|A0Q8I2|GATA_FRATN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. novicida (strain U112) GN=gatA PE=3 SV=1 60 310 1.0E-14
sp|Q7M842|GATA_WOLSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=gatA PE=3 SV=1 127 364 1.0E-14
sp|Q0BAV4|GATA_BURCM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gatA PE=3 SV=1 55 361 1.0E-14
sp|A9A9F2|GATA_METM6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gatA PE=3 SV=1 85 362 1.0E-14
sp|B2SEM6|GATA_FRATM Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gatA PE=3 SV=1 60 310 2.0E-14
sp|A1R4R1|GATA_ARTAT Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Arthrobacter aurescens (strain TC1) GN=gatA PE=3 SV=1 67 558 2.0E-14
sp|Q63YJ9|GATA_BURPS Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain K96243) GN=gatA PE=3 SV=1 55 361 2.0E-14
sp|A3N4F4|GATA_BURP6 Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Burkholderia pseudomallei (strain 668) GN=gatA PE=3 SV=1 55 361 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10423
MIPLSAWPVLLAGLSAAEPYKGVFDVSPPLIPQLGVAAGSSLFPMAECGAAGFKLEEATIEQMQDSLKAGKLTSV
ELVSCYMLRTFQTQPYINSLMQLNPNVLADAAARDEERRSADKDKDLGPLHGIPFTVKDNIAVGGNLETTAGSWA
LLGSVHEEAFVVRQLLDKGAVLFGKAAMSEWADLRSTNYSEGYSARGGQCRSAYNFTVNPGGSSSGSGVGVAANA
IAFSLGTETDGSVLNPAMRNSIVGFKPTVGLTSRGGVIPESEHQDSVGTFGRTVRDAIVAFDAIYGVDERDNYTL
AQKEANIPQDGYMQFLKSKSELANMTFGLPWKSFWTFADEESQGVLLEMVKLIEDAGATVVNETEITNHEAIVSP
NGWDWDWGRKRGFPNQSEYTVVIVDSYININAYLSELKNTKISKLDHVIKFNEDNAGSEGGFPWPDGHPAFFSGQ
DGLLASRETKGERNETYWQALEFCQTSTRRGIDDALKNRCEKRLDGLLVPLEPGQSYQIAAQAGYPMITIPAGIH
AESGMGFGLGIMQTAWGEAELIRAGSAIEDLMKGTKHERQQPQWRGYLERNMPVPL*
Coding >Hirsu2|10423
ATGATACCCCTCAGCGCCTGGCCGGTCCTGCTGGCCGGTCTGTCGGCGGCCGAGCCCTACAAAGGCGTATTCGAT
GTCTCGCCACCGTTGATCCCCCAGCTCGGAGTGGCGGCCGGATCGTCTCTATTCCCTATGGCCGAATGCGGTGCC
GCCGGCTTCAAGCTGGAGGAGGCGACCATCGAGCAGATGCAGGACAGCCTGAAGGCCGGAAAGCTGACCTCGGTC
GAGCTCGTCAGCTGCTACATGTTGAGGACATTCCAGACTCAGCCGTACATCAACTCTCTTATGCAGCTAAACCCA
AATGTGCTGGCCGATGCGGCCGCGCGCGATGAGGAGCGGCGAAGCGCAGACAAGGACAAGGACCTCGGTCCGCTA
CATGGTATCCCCTTCACCGTCAAGGACAACATCGCGGTTGGCGGAAACCTTGAGACAACGGCCGGCAGCTGGGCC
CTGCTTGGGAGCGTGCACGAGGAGGCCTTCGTCGTCAGGCAGCTGCTGGACAAGGGGGCTGTGCTCTTCGGCAAG
GCCGCCATGAGCGAATGGGCCGACCTGCGCAGCACCAACTATTCCGAGGGCTACTCGGCCCGCGGCGGGCAGTGC
CGGAGCGCCTACAACTTCACGGTGAACCCCGGCGGTAGCAGTTCGGGAAGCGGCGTCGGCGTGGCCGCCAACGCC
ATCGCCTTCTCCCTCGGCACCGAGACGGACGGCAGCGTTCTCAACCCGGCCATGCGTAACTCGATCGTGGGATTC
AAACCGACCGTCGGCCTCACCTCGCGGGGCGGCGTTATCCCGGAGTCGGAGCACCAGGACTCCGTTGGCACCTTC
GGCCGCACAGTTCGGGACGCCATTGTTGCCTTCGACGCCATCTACGGCGTCGACGAGCGCGATAACTACACACTT
GCGCAGAAGGAGGCGAACATTCCTCAGGATGGCTACATGCAGTTCCTGAAAAGCAAGAGTGAACTGGCCAACATG
ACCTTCGGTCTTCCCTGGAAAAGTTTCTGGACCTTTGCCGACGAGGAATCGCAAGGTGTGCTTCTCGAGATGGTC
AAACTGATCGAGGACGCCGGCGCAACCGTCGTCAACGAGACAGAGATCACGAATCATGAGGCGATCGTGAGCCCC
AACGGCTGGGACTGGGACTGGGGGAGGAAGAGGGGCTTCCCGAACCAGTCTGAATACACCGTCGTCATTGTCGAC
TCCTACATCAACATCAACGCCTACCTAAGTGAACTGAAAAACACCAAAATCAGCAAGCTCGACCACGTCATCAAG
TTCAATGAGGACAACGCAGGCAGCGAAGGCGGTTTCCCCTGGCCCGACGGCCATCCGGCCTTCTTCTCCGGCCAG
GACGGTCTGCTGGCCTCGCGGGAGACGAAAGGTGAACGCAACGAGACATACTGGCAGGCTTTGGAGTTCTGCCAG
ACGTCGACTCGGAGGGGCATCGACGACGCCCTCAAGAACCGCTGCGAGAAGCGACTCGATGGCCTACTCGTGCCG
CTCGAGCCGGGTCAAAGCTACCAGATAGCGGCGCAGGCCGGCTACCCCATGATCACCATCCCTGCCGGCATCCAT
GCCGAGTCGGGCATGGGTTTCGGCCTGGGCATCATGCAGACGGCTTGGGGCGAGGCGGAGCTGATACGCGCTGGC
AGCGCCATCGAGGATCTGATGAAGGGCACCAAACACGAAAGACAGCAGCCCCAGTGGCGCGGATACCTGGAGAGG
AACATGCCAGTCCCCTTATAA
Transcript >Hirsu2|10423
ATGATACCCCTCAGCGCCTGGCCGGTCCTGCTGGCCGGTCTGTCGGCGGCCGAGCCCTACAAAGGCGTATTCGAT
GTCTCGCCACCGTTGATCCCCCAGCTCGGAGTGGCGGCCGGATCGTCTCTATTCCCTATGGCCGAATGCGGTGCC
GCCGGCTTCAAGCTGGAGGAGGCGACCATCGAGCAGATGCAGGACAGCCTGAAGGCCGGAAAGCTGACCTCGGTC
GAGCTCGTCAGCTGCTACATGTTGAGGACATTCCAGACTCAGCCGTACATCAACTCTCTTATGCAGCTAAACCCA
AATGTGCTGGCCGATGCGGCCGCGCGCGATGAGGAGCGGCGAAGCGCAGACAAGGACAAGGACCTCGGTCCGCTA
CATGGTATCCCCTTCACCGTCAAGGACAACATCGCGGTTGGCGGAAACCTTGAGACAACGGCCGGCAGCTGGGCC
CTGCTTGGGAGCGTGCACGAGGAGGCCTTCGTCGTCAGGCAGCTGCTGGACAAGGGGGCTGTGCTCTTCGGCAAG
GCCGCCATGAGCGAATGGGCCGACCTGCGCAGCACCAACTATTCCGAGGGCTACTCGGCCCGCGGCGGGCAGTGC
CGGAGCGCCTACAACTTCACGGTGAACCCCGGCGGTAGCAGTTCGGGAAGCGGCGTCGGCGTGGCCGCCAACGCC
ATCGCCTTCTCCCTCGGCACCGAGACGGACGGCAGCGTTCTCAACCCGGCCATGCGTAACTCGATCGTGGGATTC
AAACCGACCGTCGGCCTCACCTCGCGGGGCGGCGTTATCCCGGAGTCGGAGCACCAGGACTCCGTTGGCACCTTC
GGCCGCACAGTTCGGGACGCCATTGTTGCCTTCGACGCCATCTACGGCGTCGACGAGCGCGATAACTACACACTT
GCGCAGAAGGAGGCGAACATTCCTCAGGATGGCTACATGCAGTTCCTGAAAAGCAAGAGTGAACTGGCCAACATG
ACCTTCGGTCTTCCCTGGAAAAGTTTCTGGACCTTTGCCGACGAGGAATCGCAAGGTGTGCTTCTCGAGATGGTC
AAACTGATCGAGGACGCCGGCGCAACCGTCGTCAACGAGACAGAGATCACGAATCATGAGGCGATCGTGAGCCCC
AACGGCTGGGACTGGGACTGGGGGAGGAAGAGGGGCTTCCCGAACCAGTCTGAATACACCGTCGTCATTGTCGAC
TCCTACATCAACATCAACGCCTACCTAAGTGAACTGAAAAACACCAAAATCAGCAAGCTCGACCACGTCATCAAG
TTCAATGAGGACAACGCAGGCAGCGAAGGCGGTTTCCCCTGGCCCGACGGCCATCCGGCCTTCTTCTCCGGCCAG
GACGGTCTGCTGGCCTCGCGGGAGACGAAAGGTGAACGCAACGAGACATACTGGCAGGCTTTGGAGTTCTGCCAG
ACGTCGACTCGGAGGGGCATCGACGACGCCCTCAAGAACCGCTGCGAGAAGCGACTCGATGGCCTACTCGTGCCG
CTCGAGCCGGGTCAAAGCTACCAGATAGCGGCGCAGGCCGGCTACCCCATGATCACCATCCCTGCCGGCATCCAT
GCCGAGTCGGGCATGGGTTTCGGCCTGGGCATCATGCAGACGGCTTGGGGCGAGGCGGAGCTGATACGCGCTGGC
AGCGCCATCGAGGATCTGATGAAGGGCACCAAACACGAAAGACAGCAGCCCCAGTGGCGCGGATACCTGGAGAGG
AACATGCCAGTCCCCTTATAA
Gene >Hirsu2|10423
ATGATACCCCTCAGCGCCTGGCCGGTCCTGCTGGCCGGTCTGTCGGCGGCCGAGCCCTACAAAGGCGTATTCGAT
GTCTCGCCACCGTTGATCCCCCAGCTCGGAGTGGCGGCCGGATCGTCTCTATTCCCTATGGCCGAATGCGGTGCC
GCCGGCTTCAAGCTGGAGGAGGCGACCATCGAGCAGATGCAGGACAGCCTGAAGGCCGGAAAGCTGACCTCGGTC
GAGCTCGTCAGCTGCTACATGTTGAGGACATTCCAGACTCAGCCGTACATCAAGTGAGTTTCGCCTGTCATCCGA
AAATGCCCCCTCCCCAGCCCCCTCCCAGAACGTACGCCTCTATGATGCACGAGCTGTCTCAGCCAGACGGGGGCT
AATAAGAATGGAATTCATCGCCTTCTGGAAAAAAACAGCTCTCTTATGCAGCTAAACCCAAATGTGCTGGCCGAT
GCGGCCGCGCGCGATGAGGAGCGGCGAAGCGCAGACAAGGACAAGGACCTCGGTCCGCTACATGGTATCCCCTTC
ACCGTCAAGGACAACATCGCGGTTGGCGGAAACCTTGAGACAACGGCCGGCAGCTGGGCCCTGCTTGGGAGCGTG
CACGAGGAGGCCTTCGTCGTCAGGCAGCTGCTGGACAAGGGGGCTGTGCTCTTCGGCAAGGCCGCCATGAGCGAA
TGGGCCGACCTGCGCAGCACCAACTATTCCGAGGGCTACTCGGCCCGCGGCGGGCAGTGCCGGAGCGCCTACAAC
TTCACGGTGAACCCCGGCGGTAGCAGTTCGGGAAGCGGCGTCGGCGTGGCCGCCAACGCCATCGCCTTCTCCCTC
GGCACCGAGACGGACGGCAGCGGTATGTAAAACCCTCGGCCGGTCATCCGCTGTGGCCTGCTGACGTGAAAACAT
GCAGTTCTCAACCCGGCCATGCGTAACTCGATCGTGGGATTCAAACCGACCGTCGGCCTCACCTCGCGGGGCGGC
GTTATCCCGGAGTCGGAGCACCAGGACTCCGTTGGCACCTTCGGCCGCACAGTTCGGGACGCCATTGTTGCCTTC
GACGCCATCTACGGCGTCGACGAGCGCGATAACTACACACTTGCGCAGAAGGAGGCGAACATTCCTCAGGATGGC
TACATGCAGTTCCTGAAAAGCAAGAGTGAACTGGCCAACATGACCTTCGGTCTTCCCTGGAAAAGTTTCTGGACC
TTTGCCGACGAGGAATCGCAAGGTGTGCTTCTCGAGATGGTCAAACTGATCGAGGACGCCGGCGCAACCGTCGTC
AACGAGACAGAGATCACGAATCATGAGGCGATCGTGAGCCCCAACGGCTGGGACTGGGACTGGGGGAGGAAGAGG
GGCTTCCCGAACCAGTCTGAATACACCGTCGTCATTGTCGACTCCTACATCAACATCAACGCCTACCTAAGTGAA
CTGAAAAACACCAAAATCAGCAAGCTCGACCACGTCATCAAGTTCAATGAGGACAACGCAGGCAGCGAAGGCGGT
TTCCCCTGGCCCGACGGCCATCCGGCCTTCTTCTCCGGCCAGGACGGTCTGCTGGCCTCGCGGGAGACGAAAGGT
GAACGCAACGAGACATACTGGCAGGCTTTGGAGTTCTGCCAGACGTCGACTCGGAGGGGCATCGACGACGCCCTC
AAGAACCGCTGCGAGAAGCGACTCGATGGCCTACTCGTGCCGCTCGAGCCGGGTCAAAGCTACCAGATAGCGGCG
CAGGCCGGCTACCCCATGATCACCATCCCTGCCGGCATCCATGCCGAGTCGGGCATGGGTTTCGGCCTGGGCATC
ATGCAGACGGCTTGGGGCGAGGCGGAGCTGATACGCGCTGGCAGCGCCATCGAGGATCTGATGAAGGGCACCAAA
CACGAAAGACAGCAGCCCCAGTGGCGCGGATACCTGGAGAGGAACATGCCAGTCCCCTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail