Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10412
Gene name
LocationContig_838:8061..11023
Strand+
Gene length (bp)2962
Transcript length (bp)2838
Coding sequence length (bp)2838
Protein length (aa) 946

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 3.9E-201 170 902

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 108 945 0.0E+00
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 97 945 0.0E+00
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 107 945 7.0E-157
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 131 930 2.0E-143
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 132 930 7.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 108 945 0.0E+00
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 97 945 0.0E+00
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 107 945 7.0E-157
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 131 930 2.0E-143
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 132 930 7.0E-141
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 134 930 5.0E-140
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 148 930 1.0E-138
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 150 930 5.0E-138
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 132 930 8.0E-138
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 132 930 9.0E-138
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 133 930 7.0E-137
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 148 930 7.0E-134
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 116 934 3.0E-104
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 111 534 3.0E-67
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 606 934 4.0E-46
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 191 213 22
2 277 296 19
3 306 325 19
4 332 354 22
5 374 396 22
6 408 430 22
7 445 467 22
8 624 643 19
9 653 675 22
10 688 710 22
11 734 756 22
12 769 791 22
13 801 823 22
14 836 858 22
15 883 905 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10412
MPSSRKTPALLAAHASGSNSPSYGALANTPALHVSQTDSDSEPDDGGAHRLGYVHDSVRSRRSMSSRRSGLSRVS
SRRSDDFDGAALLSGLEGRFGLAEAPLLGEILDHEAADSDDYDDDDTQHGLLSGGDDDDDDDDSSHTGSDFLDDS
PHEAVRASVPPTDNPTLSINTPRMWCLSVIFSILGSSTNLFFSLRYPSVAITPVIALLLVHPLGHLWDMLLKRPY
DPDEEFVDGCRVPSTPSAVRRARDEGPSRARKPNSWRLWLAQGRWNEKEHTCVYVSSNVAFGFAFATDVIVEQTR
FYKQEAPVVYQLLLTISTQILGYGFAGMARRFLVRPSGMIWPGTLMSAAMFSTLHKQDNKPANGWTISRWNFFYI
VWTVSFAFYFLPGLLFPALSYFNVITWFAPRNVVVANLFGVASGLGLFPLTFDWAQVTYVGSPLLVPWWAAVNVI
GGLVVVMWIIAPILYYSNVLYSSYMPILSPGVFDNTGHIYNVTKILTPDFLFDRDAYAGYSRVFLPITYVLSYGV
QFAGLAALLTHTLCWHGHDIWRTLRRSLREARRPGGGGGGSKTVYHQQPAANGSRAARSASSLGSEDHTWMSGST
SNVDGLLTREDIHCRLMNRYKDAPLSWYLLTFASMAAIGMFVVEYYPVHLPWYGLLLALGLGAIFFIPNGIIMAI
TNQHSSIYLICQLICGVVFPGRPIANMVFVTYGYISSAQGIKFAADLKLGHYMKIPPRVLFVVQVVATLVSSVTQ
IGVLNWMFANVDGVCTPEAVSGFTCPIARVHFNGSILWGVVGPGEFFGPAAIYRALVWCFPLGALLPVPLWLYAR
RRRASLLRKVNLPVILGAMSWIPPATGLNFSVWALVCYLFNSLIKRRAHAWWGKYTMTLSAALDSGLAFGIVVVF
FGFVYPDWMAGFRWWGTEVHKQGCDWQACPYRSVPAGETFGPREW*
Coding >Hirsu2|10412
ATGCCATCCTCCCGCAAGACGCCGGCCCTCCTCGCCGCCCACGCCTCGGGCTCCAATTCCCCCTCGTACGGCGCT
CTCGCCAACACGCCCGCCCTCCATGTCTCACAGACCGACAGCGACTCGGAGCCCGACGACGGCGGCGCCCACCGC
CTCGGCTACGTCCACGACAGTGTCCGCAGCCGGAGGAGCATGAGCTCGCGCCGCTCGGGTCTCTCTCGCGTCTCC
TCCCGCCGCTCCGACGACTTCGACGGCGCCGCCCTCCTCTCCGGCCTCGAGGGCCGCTTCGGCCTGGCCGAGGCC
CCCCTGCTTGGCGAGATCCTCGACCATGAGGCCGCTGATAGCGATGACTATGACGATGACGACACCCAGCATGGC
CTGCTCTCCGGCGGCGACGACGACGACGACGACGACGACTCGTCCCACACTGGCTCTGACTTTCTCGACGACTCC
CCCCACGAGGCCGTCCGAGCCTCGGTGCCGCCGACCGACAACCCGACCCTCTCCATCAACACGCCTCGCATGTGG
TGCCTCTCCGTCATCTTCTCCATCCTGGGATCCTCGACCAACCTGTTCTTCTCCCTGCGATACCCGAGCGTGGCC
ATCACGCCCGTCATTGCCCTGCTCCTTGTCCACCCCCTCGGCCACCTGTGGGACATGCTGCTGAAGCGGCCCTAC
GACCCCGACGAGGAATTCGTCGACGGCTGCAGGGTCCCCTCGACCCCGTCGGCCGTCCGCCGCGCCCGGGACGAG
GGGCCGTCGCGCGCCAGGAAGCCCAACTCGTGGCGCCTGTGGCTGGCGCAGGGCCGGTGGAACGAAAAGGAGCAC
ACGTGCGTCTACGTCAGCAGCAACGTCGCCTTCGGCTTCGCCTTCGCCACGGACGTCATCGTCGAGCAGACGCGC
TTCTACAAGCAGGAGGCTCCCGTCGTCTACCAGCTCCTCCTCACCATCTCGACGCAGATCCTCGGCTACGGCTTC
GCCGGCATGGCCCGCCGCTTCCTCGTCCGGCCCAGCGGCATGATCTGGCCCGGCACGCTCATGTCGGCCGCCATG
TTCTCCACCCTGCACAAGCAGGACAACAAGCCGGCCAACGGGTGGACCATCAGCCGCTGGAACTTCTTCTACATC
GTCTGGACCGTCTCCTTCGCCTTCTACTTCCTGCCGGGCCTGCTGTTCCCGGCGCTGAGCTACTTCAACGTCATC
ACCTGGTTCGCGCCCAGGAACGTCGTCGTGGCCAACCTGTTCGGCGTCGCCTCCGGCCTCGGCCTCTTCCCCCTC
ACCTTCGACTGGGCCCAGGTCACCTACGTCGGCTCGCCGCTGCTCGTGCCCTGGTGGGCCGCCGTCAACGTCATC
GGCGGCCTCGTCGTCGTCATGTGGATCATCGCGCCCATCCTCTACTACAGCAACGTGCTCTACTCGTCCTACATG
CCCATCCTGTCGCCCGGCGTCTTCGACAACACGGGGCACATCTACAACGTCACCAAGATCCTGACGCCCGACTTC
CTCTTCGACCGCGACGCCTACGCCGGCTACAGCCGCGTCTTCCTGCCCATCACCTACGTCCTCAGCTACGGCGTC
CAGTTCGCCGGCCTCGCCGCCCTGCTGACCCACACCCTGTGCTGGCACGGCCACGACATCTGGCGCACGCTGCGG
AGGAGCCTGCGCGAGGCGCGGCGGCCGGGCGGCGGCGGCGGCGGCAGCAAGACGGTCTACCACCAGCAGCCGGCC
GCCAACGGGTCGCGCGCCGCCCGGTCGGCCAGCTCCCTCGGCAGCGAGGACCACACCTGGATGTCGGGCTCGACG
TCCAACGTCGACGGGCTGCTGACGCGCGAGGACATCCACTGCCGGCTGATGAACCGCTACAAGGACGCGCCGCTG
AGCTGGTACCTGCTGACGTTTGCGTCCATGGCCGCCATCGGCATGTTCGTCGTGGAATACTACCCCGTCCACCTC
CCGTGGTACGGGCTGCTGCTGGCGCTGGGCCTGGGCGCCATCTTCTTCATCCCCAACGGCATCATCATGGCCATC
ACGAACCAGCACAGCAGCATCTACCTCATCTGCCAGCTCATCTGCGGCGTCGTGTTCCCCGGGCGGCCGATCGCC
AACATGGTCTTCGTCACGTACGGCTACATCTCGTCGGCGCAGGGCATCAAGTTCGCGGCGGACCTGAAGCTGGGC
CACTACATGAAGATCCCGCCGCGGGTGCTGTTCGTGGTGCAGGTGGTGGCGACGCTGGTGTCGTCGGTGACGCAG
ATCGGCGTGCTCAACTGGATGTTCGCCAACGTCGACGGCGTGTGCACGCCCGAGGCCGTCAGCGGCTTCACGTGC
CCGATCGCGCGCGTGCACTTCAACGGCTCGATCCTGTGGGGCGTCGTCGGCCCCGGCGAGTTCTTCGGCCCGGCC
GCCATCTACCGCGCGCTCGTCTGGTGCTTCCCGCTCGGGGCGCTGCTGCCGGTGCCGCTGTGGCTGTACGCGCGC
CGGCGCCGGGCCAGCCTGCTGCGCAAGGTCAACCTGCCCGTCATCCTGGGCGCCATGTCGTGGATCCCGCCCGCG
ACCGGCCTCAACTTCTCCGTCTGGGCCCTCGTCTGCTACCTCTTCAACTCGCTCATCAAGCGCCGCGCCCACGCC
TGGTGGGGCAAGTACACCATGACGCTCAGCGCCGCCCTCGACTCGGGCCTCGCCTTCGGCATCGTCGTCGTCTTC
TTCGGCTTCGTCTACCCGGACTGGATGGCCGGCTTCCGCTGGTGGGGCACCGAAGTCCACAAGCAGGGCTGCGAC
TGGCAGGCCTGCCCCTACCGCTCCGTGCCCGCCGGCGAGACGTTTGGGCCGCGCGAGTGGTGA
Transcript >Hirsu2|10412
ATGCCATCCTCCCGCAAGACGCCGGCCCTCCTCGCCGCCCACGCCTCGGGCTCCAATTCCCCCTCGTACGGCGCT
CTCGCCAACACGCCCGCCCTCCATGTCTCACAGACCGACAGCGACTCGGAGCCCGACGACGGCGGCGCCCACCGC
CTCGGCTACGTCCACGACAGTGTCCGCAGCCGGAGGAGCATGAGCTCGCGCCGCTCGGGTCTCTCTCGCGTCTCC
TCCCGCCGCTCCGACGACTTCGACGGCGCCGCCCTCCTCTCCGGCCTCGAGGGCCGCTTCGGCCTGGCCGAGGCC
CCCCTGCTTGGCGAGATCCTCGACCATGAGGCCGCTGATAGCGATGACTATGACGATGACGACACCCAGCATGGC
CTGCTCTCCGGCGGCGACGACGACGACGACGACGACGACTCGTCCCACACTGGCTCTGACTTTCTCGACGACTCC
CCCCACGAGGCCGTCCGAGCCTCGGTGCCGCCGACCGACAACCCGACCCTCTCCATCAACACGCCTCGCATGTGG
TGCCTCTCCGTCATCTTCTCCATCCTGGGATCCTCGACCAACCTGTTCTTCTCCCTGCGATACCCGAGCGTGGCC
ATCACGCCCGTCATTGCCCTGCTCCTTGTCCACCCCCTCGGCCACCTGTGGGACATGCTGCTGAAGCGGCCCTAC
GACCCCGACGAGGAATTCGTCGACGGCTGCAGGGTCCCCTCGACCCCGTCGGCCGTCCGCCGCGCCCGGGACGAG
GGGCCGTCGCGCGCCAGGAAGCCCAACTCGTGGCGCCTGTGGCTGGCGCAGGGCCGGTGGAACGAAAAGGAGCAC
ACGTGCGTCTACGTCAGCAGCAACGTCGCCTTCGGCTTCGCCTTCGCCACGGACGTCATCGTCGAGCAGACGCGC
TTCTACAAGCAGGAGGCTCCCGTCGTCTACCAGCTCCTCCTCACCATCTCGACGCAGATCCTCGGCTACGGCTTC
GCCGGCATGGCCCGCCGCTTCCTCGTCCGGCCCAGCGGCATGATCTGGCCCGGCACGCTCATGTCGGCCGCCATG
TTCTCCACCCTGCACAAGCAGGACAACAAGCCGGCCAACGGGTGGACCATCAGCCGCTGGAACTTCTTCTACATC
GTCTGGACCGTCTCCTTCGCCTTCTACTTCCTGCCGGGCCTGCTGTTCCCGGCGCTGAGCTACTTCAACGTCATC
ACCTGGTTCGCGCCCAGGAACGTCGTCGTGGCCAACCTGTTCGGCGTCGCCTCCGGCCTCGGCCTCTTCCCCCTC
ACCTTCGACTGGGCCCAGGTCACCTACGTCGGCTCGCCGCTGCTCGTGCCCTGGTGGGCCGCCGTCAACGTCATC
GGCGGCCTCGTCGTCGTCATGTGGATCATCGCGCCCATCCTCTACTACAGCAACGTGCTCTACTCGTCCTACATG
CCCATCCTGTCGCCCGGCGTCTTCGACAACACGGGGCACATCTACAACGTCACCAAGATCCTGACGCCCGACTTC
CTCTTCGACCGCGACGCCTACGCCGGCTACAGCCGCGTCTTCCTGCCCATCACCTACGTCCTCAGCTACGGCGTC
CAGTTCGCCGGCCTCGCCGCCCTGCTGACCCACACCCTGTGCTGGCACGGCCACGACATCTGGCGCACGCTGCGG
AGGAGCCTGCGCGAGGCGCGGCGGCCGGGCGGCGGCGGCGGCGGCAGCAAGACGGTCTACCACCAGCAGCCGGCC
GCCAACGGGTCGCGCGCCGCCCGGTCGGCCAGCTCCCTCGGCAGCGAGGACCACACCTGGATGTCGGGCTCGACG
TCCAACGTCGACGGGCTGCTGACGCGCGAGGACATCCACTGCCGGCTGATGAACCGCTACAAGGACGCGCCGCTG
AGCTGGTACCTGCTGACGTTTGCGTCCATGGCCGCCATCGGCATGTTCGTCGTGGAATACTACCCCGTCCACCTC
CCGTGGTACGGGCTGCTGCTGGCGCTGGGCCTGGGCGCCATCTTCTTCATCCCCAACGGCATCATCATGGCCATC
ACGAACCAGCACAGCAGCATCTACCTCATCTGCCAGCTCATCTGCGGCGTCGTGTTCCCCGGGCGGCCGATCGCC
AACATGGTCTTCGTCACGTACGGCTACATCTCGTCGGCGCAGGGCATCAAGTTCGCGGCGGACCTGAAGCTGGGC
CACTACATGAAGATCCCGCCGCGGGTGCTGTTCGTGGTGCAGGTGGTGGCGACGCTGGTGTCGTCGGTGACGCAG
ATCGGCGTGCTCAACTGGATGTTCGCCAACGTCGACGGCGTGTGCACGCCCGAGGCCGTCAGCGGCTTCACGTGC
CCGATCGCGCGCGTGCACTTCAACGGCTCGATCCTGTGGGGCGTCGTCGGCCCCGGCGAGTTCTTCGGCCCGGCC
GCCATCTACCGCGCGCTCGTCTGGTGCTTCCCGCTCGGGGCGCTGCTGCCGGTGCCGCTGTGGCTGTACGCGCGC
CGGCGCCGGGCCAGCCTGCTGCGCAAGGTCAACCTGCCCGTCATCCTGGGCGCCATGTCGTGGATCCCGCCCGCG
ACCGGCCTCAACTTCTCCGTCTGGGCCCTCGTCTGCTACCTCTTCAACTCGCTCATCAAGCGCCGCGCCCACGCC
TGGTGGGGCAAGTACACCATGACGCTCAGCGCCGCCCTCGACTCGGGCCTCGCCTTCGGCATCGTCGTCGTCTTC
TTCGGCTTCGTCTACCCGGACTGGATGGCCGGCTTCCGCTGGTGGGGCACCGAAGTCCACAAGCAGGGCTGCGAC
TGGCAGGCCTGCCCCTACCGCTCCGTGCCCGCCGGCGAGACGTTTGGGCCGCGCGAGTGGTGA
Gene >Hirsu2|10412
ATGCCATCCTCCCGCAAGACGCCGGCCCTCCTCGCCGCCCACGCCTCGGGCTCCAATTCCCCCTCGTACGGCGCT
CTCGCCAACACGCCCGCCCTCCATGTCTCACAGACCGACAGCGACTCGGAGCCCGACGACGGCGGCGCCCACCGC
CTCGGCTACGTCCACGACAGTGTCCGCAGCCGGAGGAGCATGAGCTCGCGCCGCTCGGGTCTCTCTCGCGTCTCC
TCCCGCCGCTCCGACGACTTCGACGGCGCCGCCCTCCTCTCCGGCCTCGAGGGCCGCTTCGGCCTGGCCGAGGCC
CCCCTGCTTGGCGAGATCCTCGACCATGAGGCCGCTGATAGCGATGACTATGACGATGACGACACCCAGCATGGC
CTGCTCTCCGGCGGCGACGACGACGACGACGACGACGACTCGTCCCACACTGGCTCTGACTTTCTCGACGACTCC
CCCCACGAGGCCGTCCGAGCCTCGGTGCCGCCGACCGACAACCCGACCCTCTCCATCAACACGCCTCGCATGTGG
TGCCTCTCCGTCATCTTCTCCATCCTGGGATCCTCGACCAACCTGTTCTTCTCCCTGCGATACCCGAGCGTGGCC
ATCACGCCCGTCATTGCCCTGCTCCTTGTCCACCCCCTCGGCCACCTGTGGGACATGCTGCTGAAGCGGCCCTAC
GACCCCGACGAGGAATTCGTCGACGGCTGCAGGGTCCCCTCGACCCCGTCGGCCGTCCGCCGCGCCCGGGACGAG
GGGCCGTCGCGCGCCAGGAAGCCCAACTCGTGGCGCCTGTGGCTGGCGCAGGGCCGGTGGAACGAAAAGGAGCAC
ACGTGCGTCTACGTCAGCAGCAACGTCGCCTTCGGCTTCGCCTTCGCCACGGACGTCATCGTCGAGCAGACGCGC
TTCTACAAGCAGGAGGCTCCCGTCGTCTACCAGCTCCTCCTCACCATCTCGACGCAGATCCTCGGCTACGGCTTC
GCCGGCATGGCCCGCCGCTTCCTCGTCCGGCCCAGCGGCATGATCTGGCCCGGCACGCTCATGTCGGCCGCCATG
TTCTCCACCCTGCACAAGCAGGACAACAAGCCGGCCAACGGGTGGACCATCAGCCGCTGGAACTTCTTCTACATC
GTCTGGACCGTCTCCTTCGCCTTCTACTTCCTGCCGGGCCTGCTGTTCCCGGCGCTGAGCTACTTCAACGTCATC
ACCTGGTTCGCGCCCAGGAACGTCGTCGTGGCCAACCTGTTCGGCGTCGCCTCCGGCCTCGGCCTCTTCCCCCTC
ACCTTCGACTGGGCCCAGGTCACCTACGTCGGCTCGCCGCTGCTCGTGCCCTGGTGGGCCGCCGTCAACGTCATC
GGCGGCCTCGTCGTCGTCATGTGGATCATCGCGCCCATCCTCTACTACAGCAACGTGCTCTACTCGTCCTACATG
CCCATCCTGTCGCCCGGCGTCTTCGACAACACGGGGCACATCTACAACGTCACCAAGATCCTGACGCCCGACTTC
CTCTTCGACCGCGACGCCTACGCCGGCTACAGCCGCGTCTTCCTGCCCATCACCTACGTCCTCAGCTACGGCGTC
CAGTTCGCCGGCCTCGCCGCCCTGCTGACCCACACCCTGTGCTGGCACGGCCACGACATCTGGCGCACGCTGCGG
AGGAGCCTGCGCGAGGCGCGGCGGCCGGGCGGCGGCGGCGGCGGCAGCAAGACGGTCTACCACCAGCAGCCGGCC
GCCAACGGGTCGCGCGCCGCCCGGTCGGCCAGCTCCCTCGGCAGCGAGGACCACACCTGGATGTCGGGCTCGACG
TCCAACGTCGACGGGCTGCTGACGCGCGAGGACATCCACTGCCGGCTGATGAACCGCTACAAGGACGCGCCGCTG
AGCTGGTACCTGCTGACGTTTGCGTCCATGGCCGCCATCGGCATGTTCGTCGTGGAATAGTGAGTTTTGTGCAGA
CCCCGTGTCCCGTCTGCCTGCCTGCCCTGCCCTGCCCTGCCCTGCCCATCCACCCCCCGGACGTCTTGCTTCTTT
TTTTTTTTTTTGCTGACGGCGTTCGTCTCCCAGCTACCCCGTCCACCTCCCGTGGTACGGGCTGCTGCTGGCGCT
GGGCCTGGGCGCCATCTTCTTCATCCCCAACGGCATCATCATGGCCATCACGAACCAGCACAGCAGCATCTACCT
CATCTGCCAGCTCATCTGCGGCGTCGTGTTCCCCGGGCGGCCGATCGCCAACATGGTCTTCGTCACGTACGGCTA
CATCTCGTCGGCGCAGGGCATCAAGTTCGCGGCGGACCTGAAGCTGGGCCACTACATGAAGATCCCGCCGCGGGT
GCTGTTCGTGGTGCAGGTGGTGGCGACGCTGGTGTCGTCGGTGACGCAGATCGGCGTGCTCAACTGGATGTTCGC
CAACGTCGACGGCGTGTGCACGCCCGAGGCCGTCAGCGGCTTCACGTGCCCGATCGCGCGCGTGCACTTCAACGG
CTCGATCCTGTGGGGCGTCGTCGGCCCCGGCGAGTTCTTCGGCCCGGCCGCCATCTACCGCGCGCTCGTCTGGTG
CTTCCCGCTCGGGGCGCTGCTGCCGGTGCCGCTGTGGCTGTACGCGCGCCGGCGCCGGGCCAGCCTGCTGCGCAA
GGTCAACCTGCCCGTCATCCTGGGCGCCATGTCGTGGATCCCGCCCGCGACCGGCCTCAACTTCTCCGTCTGGGC
CCTCGTCTGCTACCTCTTCAACTCGCTCATCAAGCGCCGCGCCCACGCCTGGTGGGGCAAGTACACCATGACGCT
CAGCGCCGCCCTCGACTCGGGCCTCGCCTTCGGCATCGTCGTCGTCTTCTTCGGCTTCGTCTACCCGGACTGGAT
GGCCGGCTTCCGCTGGTGGGGCACCGAAGTCCACAAGCAGGGCTGCGACTGGCAGGCCTGCCCCTACCGCTCCGT
GCCCGCCGGCGAGACGTTTGGGCCGCGCGAGTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail