Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1040
Gene name
LocationContig_1215:1580..2970
Strand-
Gene length (bp)1390
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04982 HPP HPP family 4.3E-39 82 206

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q55EF8|Y9096_DICDI Transmembrane protein DDB_G0269096 OS=Dictyostelium discoideum GN=DDB_G0269096 PE=4 SV=1 46 210 6.0E-20
sp|Q556Z9|Y3361_DICDI Transmembrane protein DDB_G0273707/DDB_G0273361 OS=Dictyostelium discoideum GN=DDB_G0273707 PE=4 SV=2 45 210 1.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 78 97 19
3 134 156 22
4 176 198 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1040
MRHRTWNFDIDRFLNPLVPPPPWRWLPYPVARFLGYRRTAPAETGNLMPIFWAFLGILGCILVIEAVSSHVPVFK
DHGAPMIVGSFGAAAVLEFYAIESPLSQPRNAVLGQTLASIVGVGVAKLFQLSDRFHQIRWVGGALSCASATALM
ALTKTVHPPAGATALLAVADDHLVALGWLLVPLVLLGCALMLAVALLVNNIERRFPLYWWTPMDLRQRRPVGRPA
LVVVRRAGWRIGGRKAKQEQQVRQQRRQQQQQQRQQRQQRQRDEEEAEHEGKVGAEDEYDDDDDQVVLPGSNNRV
LTHDEERTVGGDGSGPDAPHPAPPGAGTTTLWSRAPAEVVIRPGQVFVPEHMLRALTPEETVLLESMSHRL*
Coding >Hirsu2|1040
ATGCGGCACCGGACGTGGAACTTTGACATCGACCGCTTCCTCAACCCGCTCGTGCCGCCGCCGCCCTGGCGATGG
CTCCCCTACCCCGTCGCCCGCTTCCTGGGCTACCGCCGCACCGCGCCGGCCGAGACGGGCAACCTCATGCCCATC
TTCTGGGCCTTTCTCGGCATCCTGGGCTGCATCCTCGTCATTGAGGCCGTCTCGAGCCACGTGCCGGTCTTCAAG
GACCACGGCGCCCCCATGATTGTCGGCTCCTTTGGCGCGGCAGCCGTGCTCGAGTTCTATGCCATCGAGTCGCCG
CTCTCGCAGCCGCGCAACGCCGTCCTCGGCCAGACGCTCGCCAGCATCGTCGGCGTCGGGGTCGCCAAGCTGTTC
CAGCTCAGCGACCGCTTCCACCAGATCCGCTGGGTGGGCGGCGCGCTGTCGTGCGCCTCGGCCACGGCCCTCATG
GCCCTGACCAAGACGGTGCACCCACCCGCCGGCGCGACCGCGCTGCTGGCCGTCGCCGACGACCACCTCGTCGCC
CTCGGCTGGCTGCTCGTCCCGCTCGTCCTACTCGGCTGCGCACTGATGCTGGCCGTCGCCCTGCTCGTCAACAAC
ATTGAGCGCCGCTTTCCGCTGTACTGGTGGACGCCCATGGACTTGAGGCAGAGGCGGCCGGTCGGCCGGCCGGCC
TTGGTCGTCGTCCGCCGGGCGGGGTGGAGGATCGGAGGACGCAAGGCGAAGCAAGAACAGCAGGTCCGCCAGCAG
CGGCGCCAGCAACAACAGCAACAACGGCAGCAACGGCAGCAACGGCAGCGGGACGAAGAGGAGGCGGAACACGAG
GGCAAGGTGGGCGCCGAGGACGAATACGACGACGACGACGACCAGGTGGTGCTCCCGGGCAGCAACAACCGGGTC
CTGACGCACGACGAGGAGAGGACGGTCGGGGGCGACGGGTCGGGGCCGGACGCGCCGCATCCCGCGCCGCCCGGC
GCCGGGACGACGACGCTCTGGAGCCGGGCGCCGGCCGAGGTCGTCATCCGGCCCGGGCAGGTCTTCGTGCCGGAG
CACATGCTGCGCGCGCTGACGCCGGAGGAGACGGTGCTCCTGGAGTCCATGAGCCACCGGCTGTGA
Transcript >Hirsu2|1040
ATGCGGCACCGGACGTGGAACTTTGACATCGACCGCTTCCTCAACCCGCTCGTGCCGCCGCCGCCCTGGCGATGG
CTCCCCTACCCCGTCGCCCGCTTCCTGGGCTACCGCCGCACCGCGCCGGCCGAGACGGGCAACCTCATGCCCATC
TTCTGGGCCTTTCTCGGCATCCTGGGCTGCATCCTCGTCATTGAGGCCGTCTCGAGCCACGTGCCGGTCTTCAAG
GACCACGGCGCCCCCATGATTGTCGGCTCCTTTGGCGCGGCAGCCGTGCTCGAGTTCTATGCCATCGAGTCGCCG
CTCTCGCAGCCGCGCAACGCCGTCCTCGGCCAGACGCTCGCCAGCATCGTCGGCGTCGGGGTCGCCAAGCTGTTC
CAGCTCAGCGACCGCTTCCACCAGATCCGCTGGGTGGGCGGCGCGCTGTCGTGCGCCTCGGCCACGGCCCTCATG
GCCCTGACCAAGACGGTGCACCCACCCGCCGGCGCGACCGCGCTGCTGGCCGTCGCCGACGACCACCTCGTCGCC
CTCGGCTGGCTGCTCGTCCCGCTCGTCCTACTCGGCTGCGCACTGATGCTGGCCGTCGCCCTGCTCGTCAACAAC
ATTGAGCGCCGCTTTCCGCTGTACTGGTGGACGCCCATGGACTTGAGGCAGAGGCGGCCGGTCGGCCGGCCGGCC
TTGGTCGTCGTCCGCCGGGCGGGGTGGAGGATCGGAGGACGCAAGGCGAAGCAAGAACAGCAGGTCCGCCAGCAG
CGGCGCCAGCAACAACAGCAACAACGGCAGCAACGGCAGCAACGGCAGCGGGACGAAGAGGAGGCGGAACACGAG
GGCAAGGTGGGCGCCGAGGACGAATACGACGACGACGACGACCAGGTGGTGCTCCCGGGCAGCAACAACCGGGTC
CTGACGCACGACGAGGAGAGGACGGTCGGGGGCGACGGGTCGGGGCCGGACGCGCCGCATCCCGCGCCGCCCGGC
GCCGGGACGACGACGCTCTGGAGCCGGGCGCCGGCCGAGGTCGTCATCCGGCCCGGGCAGGTCTTCGTGCCGGAG
CACATGCTGCGCGCGCTGACGCCGGAGGAGACGGTGCTCCTGGAGTCCATGAGCCACCGGCTGTGA
Gene >Hirsu2|1040
ATGCGGCACCGGACGTGGAACTTTGACATCGACCGCTTCCTCAACCCGCTCGTGCCGCCGCCGCCCTGGCGATGG
CTCCCCTACCCCGTCGCCCGCTTCCTGGGCTACCGCCGCACCGCGCCGGCCGAGACGGGCAACCTCATGCCCATC
TTCTGGGCCTTTCTCGGCATCCTGGGCTGCATCCTCGTCATTGAGGCCGTCTCGAGCCACGTGCCGGTCTTCAAG
GACCACGGCGCCCCCATGATTGTCGGCTCCTTTGTACGTCGTTGCTCCTCTCACTGCCTCCCTGTCCCTGCTTCC
CTGTCCCCCTTGGTCCCTGGTTCTCCCTTTGCCGTTCTTCTTCTCTCTCTCTCTCTCTGTCTCTCTCCCTGTCTC
TCTCCCTCTCACCATCTGCCTCTCTCTCTCTCCCCCTCTCTCCTCTCCACCTCNNNNNNNNNNNNNNNNNNNNNN
CCCCCTCCCCCCCCTTCTCCCACCTTCTCCGCCGTGTTCCACATCCCGCTCGGCTGACACCCGGGGTTCCCCGGC
AGCGCAGGGCGCGGCAGCCGTGCTCGAGTTCTATGCCATCGAGTCGCCGCTCTCGCAGCCGCGCAACGCCGTCCT
CGGCCAGACGCTCGCCAGCATCGTCGGCGTCGGGGTCGCCAAGCTGTTCCAGCTCAGCGACCGCTTCCACCAGAT
CCGCTGGGTGGGCGGCGCGCTGTCGTGCGCCTCGGCCACGGCCCTCATGGCCCTGACCAAGACGGTGCACCCACC
CGCCGGCGCGACCGCGCTGCTGGCCGTCGCCGACGACCACCTCGTCGCCCTCGGCTGGCTGCTCGTCCCGCTCGT
CCTACTCGGCTGCGCACTGATGCTGGCCGTCGCCCTGCTCGTCAACAACATTGAGCGCCGCTTTCCGCTGTACTG
GTGGACGCCCATGGACTTGAGGCAGAGGCGGCCGGTCGGCCGGCCGGCCTTGGTCGTCGTCCGCCGGGCGGGGTG
GAGGATCGGAGGACGCAAGGCGAAGCAAGAACAGCAGGTCCGCCAGCAGCGGCGCCAGCAACAACAGCAACAACG
GCAGCAACGGCAGCAACGGCAGCGGGACGAAGAGGAGGCGGAACACGAGGGCAAGGTGGGCGCCGAGGACGAATA
CGACGACGACGACGACCAGGTGGTGCTCCCGGGCAGCAACAACCGGGTCCTGACGCACGACGAGGAGAGGACGGT
CGGGGGCGACGGGTCGGGGCCGGACGCGCCGCATCCCGCGCCGCCCGGCGCCGGGACGACGACGCTCTGGAGCCG
GGCGCCGGCCGAGGTCGTCATCCGGCCCGGGCAGGTCTTCGTGCCGGAGCACATGCTGCGCGCGCTGACGCCGGA
GGAGACGGTGCTCCTGGAGTCCATGAGCCACCGGCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail