Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10375
Gene name
LocationContig_830:5243..7339
Strand+
Gene length (bp)2096
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.2E-29 142 541
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.4E-11 208 554

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 139 609 5.0E-76
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 109 618 2.0E-48
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 114 618 4.0E-45
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 102 568 2.0E-41
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 142 619 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 139 609 5.0E-76
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 109 618 2.0E-48
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 114 618 4.0E-45
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 102 568 2.0E-41
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 142 619 2.0E-40
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 142 619 2.0E-40
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 78 554 2.0E-39
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 153 505 8.0E-31
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 223 568 6.0E-30
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 138 539 2.0E-28
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 160 523 2.0E-28
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 151 520 2.0E-27
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 150 485 6.0E-22
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 150 485 9.0E-22
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 202 469 2.0E-19
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 153 623 3.0E-18
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 129 463 1.0E-17
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 152 477 4.0E-17
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 199 563 4.0E-14
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 199 563 4.0E-14
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 173 542 4.0E-14
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 146 557 3.0E-12
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 146 557 3.0E-12
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 202 447 5.0E-12
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 202 447 2.0E-11
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 136 622 3.0E-11
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 139 441 4.0E-11
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 202 447 1.0E-10
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 136 622 2.0E-10
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 142 521 2.0E-10
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 202 569 5.0E-10
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 202 569 5.0E-10
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 202 447 1.0E-09
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 194 467 1.0E-09
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 198 447 2.0E-09
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 206 480 2.0E-09
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 131 444 6.0E-09
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 202 298 8.0E-09
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 145 477 1.0E-08
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 202 467 2.0E-08
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 198 447 2.0E-08
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 202 447 3.0E-08
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 198 447 4.0E-08
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 170 296 1.0E-07
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 152 471 1.0E-07
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 170 296 1.0E-07
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 208 345 3.0E-07
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 130 451 3.0E-07
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 202 298 3.0E-07
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 149 325 4.0E-07
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 202 327 5.0E-07
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 190 302 6.0E-07
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 198 447 6.0E-07
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 202 298 6.0E-07
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 202 298 6.0E-07
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 202 298 7.0E-07
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 202 298 7.0E-07
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 202 298 7.0E-07
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 202 298 7.0E-07
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 202 298 7.0E-07
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 202 298 7.0E-07
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 202 298 7.0E-07
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 202 447 1.0E-06
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 208 345 1.0E-06
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 199 623 1.0E-06
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 199 623 1.0E-06
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 149 325 1.0E-06
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 149 325 1.0E-06
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 149 325 1.0E-06
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 149 325 1.0E-06
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 149 325 1.0E-06
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 149 325 2.0E-06
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 149 325 2.0E-06
sp|P9WJX3|Y1634_MYCTU Probable multidrug-efflux transporter Rv1634 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1634 PE=1 SV=1 199 291 2.0E-06
sp|P9WJX2|Y1634_MYCTO Probable multidrug-efflux transporter MT1670 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1670 PE=3 SV=1 199 291 2.0E-06
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 170 468 4.0E-06
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 153 357 5.0E-06
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 202 298 6.0E-06
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 149 325 6.0E-06
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 155 318 7.0E-06
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 173 481 8.0E-06
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 199 293 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 140 162 22
2 172 189 17
3 196 218 22
4 228 250 22
5 257 279 22
6 289 311 22
7 332 350 18
8 360 382 22
9 403 425 22
10 440 457 17
11 464 483 19
12 493 515 22
13 524 546 22
14 597 619 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10375
MDSKGTPETQSAKGAEAMPRPANRLRPGMRTSTIGAEELSVFSPLEVTQITALDFVFPSRRVSWRQSVLSDGGLS
AQFPARTPKGQLRPDSYLGHQSRLEPLHDPDSDGQSGLSRHSGGEADLEFLDLEDEQEYPTGAKLFIMIAALVFS
IFLIALDMATITDEFKGLQDVAWYGAVFFMTAGGFQSTWGKTYKFFPLKIAFLTAIFIFEVGSLICGVAPSSTVF
IIGRAIAGIGAAGVGSGSYTMVAFIAKPKSRAAYTGLLGAVYGVASVLGPLLGGVFSGATTWRWCFYINLPIGAL
PVGTIVFLFHPPKAAKPQEATLKEKLLQMDPLGTSFMMGAIITYLIAVNYGGQTYPWSSSMVIGLLVGSGLLAIA
FGLCEFWQDERAIVIPRLIGKREIGLSAFFSIMQSGAFYCMIYYLPIYFQAIRGSDPIMSGVQNLPFILAAMLGA
LSAGIFISRTGMSTIVMVGGAGLGVLGSGLCYTLDRNTSTGAWVGYQIVAGLGLGGAMQIPVIVCQVSVELVDLS
SATAMILCFQTLGGAIWLSAAQSAFVNRMLLAVPNTAPGVDPMRVVATGAGQLHKAFREDELAGVLAAYLDGIKI
AFVLSCAIVGAAFVLGLFLPWRRHDTAAIQNSAGAA*
Coding >Hirsu2|10375
ATGGACTCCAAAGGGACGCCAGAGACCCAGAGCGCCAAGGGGGCCGAGGCCATGCCACGGCCGGCCAACAGACTG
CGGCCCGGCATGAGGACGTCGACGATTGGGGCCGAGGAACTGTCCGTCTTCAGCCCTCTCGAGGTGACGCAGATC
ACCGCCTTGGACTTCGTCTTTCCCTCGCGGAGGGTAAGCTGGCGCCAGTCCGTCCTCAGCGACGGGGGACTGAGC
GCTCAGTTCCCGGCTCGGACGCCCAAGGGCCAGCTGCGTCCCGACTCCTATCTGGGCCACCAGAGCCGACTCGAG
CCCCTTCACGACCCAGACTCGGACGGCCAGTCCGGCTTGTCCCGACACTCAGGAGGGGAGGCCGACCTCGAGTTT
CTGGACTTGGAGGATGAGCAAGAGTATCCCACCGGGGCCAAACTGTTCATCATGATCGCCGCCCTGGTCTTTAGC
ATCTTCCTCATCGCTCTTGACATGGCAACCATCACGGACGAGTTCAAGGGCCTTCAGGACGTGGCGTGGTACGGA
GCCGTCTTTTTCATGACCGCCGGCGGCTTTCAATCCACCTGGGGCAAGACGTACAAGTTTTTCCCCCTCAAGATC
GCCTTCTTGACCGCAATCTTCATCTTCGAGGTCGGCAGTCTGATATGCGGAGTGGCGCCGTCGTCGACCGTCTTC
ATCATTGGTCGGGCCATTGCAGGCATCGGGGCCGCAGGCGTCGGCTCGGGCTCCTACACCATGGTTGCCTTCATA
GCCAAGCCCAAGAGCAGGGCGGCCTACACCGGCCTCCTCGGGGCTGTCTATGGCGTGGCCAGCGTTCTCGGCCCC
CTCTTGGGCGGCGTCTTCTCCGGCGCCACTACTTGGAGATGGTGCTTCTATATCAATCTCCCGATAGGCGCCCTC
CCAGTCGGCACAATCGTCTTCCTTTTCCACCCTCCCAAGGCGGCCAAGCCGCAGGAGGCAACGCTCAAGGAGAAG
CTTCTCCAGATGGACCCTCTCGGGACCAGCTTCATGATGGGCGCCATCATCACCTATCTCATTGCCGTCAACTAC
GGCGGCCAGACGTACCCGTGGTCTTCGTCCATGGTCATCGGTCTTCTCGTCGGCTCGGGCCTCCTCGCCATTGCC
TTTGGGCTGTGCGAGTTTTGGCAGGACGAGCGGGCCATCGTCATCCCCAGGCTGATCGGCAAGCGCGAAATCGGA
CTGTCGGCATTCTTCTCCATCATGCAGTCGGGGGCCTTCTACTGCATGATCTATTACCTGCCCATCTATTTCCAG
GCCATCAGAGGTAGCGACCCCATCATGTCGGGCGTGCAGAACCTGCCGTTCATCCTGGCCGCCATGCTGGGCGCC
CTCAGCGCCGGCATCTTCATCTCGAGAACGGGCATGTCGACCATAGTCATGGTCGGCGGCGCGGGCCTGGGGGTG
CTTGGTAGCGGCCTGTGCTACACGCTTGACAGGAACACGTCGACGGGCGCCTGGGTCGGATACCAGATCGTGGCC
GGACTCGGCCTCGGCGGTGCCATGCAGATCCCCGTCATTGTCTGCCAGGTCAGCGTCGAGCTGGTTGACCTGTCC
TCGGCCACGGCCATGATCCTGTGCTTCCAGACTCTGGGCGGCGCCATCTGGCTATCGGCTGCCCAGTCGGCCTTT
GTCAACAGGATGTTGCTCGCTGTGCCCAACACGGCCCCGGGCGTGGACCCGATGCGCGTCGTGGCCACCGGCGCC
GGCCAGCTGCACAAGGCCTTTAGGGAAGACGAGCTGGCAGGGGTGCTGGCCGCCTATCTCGACGGCATCAAGATA
GCCTTCGTGCTCTCGTGCGCCATCGTAGGCGCCGCGTTCGTGCTCGGATTGTTTCTGCCATGGAGGCGGCATGAC
ACGGCCGCTATTCAGAACAGTGCCGGGGCTGCATGA
Transcript >Hirsu2|10375
ATGGACTCCAAAGGGACGCCAGAGACCCAGAGCGCCAAGGGGGCCGAGGCCATGCCACGGCCGGCCAACAGACTG
CGGCCCGGCATGAGGACGTCGACGATTGGGGCCGAGGAACTGTCCGTCTTCAGCCCTCTCGAGGTGACGCAGATC
ACCGCCTTGGACTTCGTCTTTCCCTCGCGGAGGGTAAGCTGGCGCCAGTCCGTCCTCAGCGACGGGGGACTGAGC
GCTCAGTTCCCGGCTCGGACGCCCAAGGGCCAGCTGCGTCCCGACTCCTATCTGGGCCACCAGAGCCGACTCGAG
CCCCTTCACGACCCAGACTCGGACGGCCAGTCCGGCTTGTCCCGACACTCAGGAGGGGAGGCCGACCTCGAGTTT
CTGGACTTGGAGGATGAGCAAGAGTATCCCACCGGGGCCAAACTGTTCATCATGATCGCCGCCCTGGTCTTTAGC
ATCTTCCTCATCGCTCTTGACATGGCAACCATCACGGACGAGTTCAAGGGCCTTCAGGACGTGGCGTGGTACGGA
GCCGTCTTTTTCATGACCGCCGGCGGCTTTCAATCCACCTGGGGCAAGACGTACAAGTTTTTCCCCCTCAAGATC
GCCTTCTTGACCGCAATCTTCATCTTCGAGGTCGGCAGTCTGATATGCGGAGTGGCGCCGTCGTCGACCGTCTTC
ATCATTGGTCGGGCCATTGCAGGCATCGGGGCCGCAGGCGTCGGCTCGGGCTCCTACACCATGGTTGCCTTCATA
GCCAAGCCCAAGAGCAGGGCGGCCTACACCGGCCTCCTCGGGGCTGTCTATGGCGTGGCCAGCGTTCTCGGCCCC
CTCTTGGGCGGCGTCTTCTCCGGCGCCACTACTTGGAGATGGTGCTTCTATATCAATCTCCCGATAGGCGCCCTC
CCAGTCGGCACAATCGTCTTCCTTTTCCACCCTCCCAAGGCGGCCAAGCCGCAGGAGGCAACGCTCAAGGAGAAG
CTTCTCCAGATGGACCCTCTCGGGACCAGCTTCATGATGGGCGCCATCATCACCTATCTCATTGCCGTCAACTAC
GGCGGCCAGACGTACCCGTGGTCTTCGTCCATGGTCATCGGTCTTCTCGTCGGCTCGGGCCTCCTCGCCATTGCC
TTTGGGCTGTGCGAGTTTTGGCAGGACGAGCGGGCCATCGTCATCCCCAGGCTGATCGGCAAGCGCGAAATCGGA
CTGTCGGCATTCTTCTCCATCATGCAGTCGGGGGCCTTCTACTGCATGATCTATTACCTGCCCATCTATTTCCAG
GCCATCAGAGGTAGCGACCCCATCATGTCGGGCGTGCAGAACCTGCCGTTCATCCTGGCCGCCATGCTGGGCGCC
CTCAGCGCCGGCATCTTCATCTCGAGAACGGGCATGTCGACCATAGTCATGGTCGGCGGCGCGGGCCTGGGGGTG
CTTGGTAGCGGCCTGTGCTACACGCTTGACAGGAACACGTCGACGGGCGCCTGGGTCGGATACCAGATCGTGGCC
GGACTCGGCCTCGGCGGTGCCATGCAGATCCCCGTCATTGTCTGCCAGGTCAGCGTCGAGCTGGTTGACCTGTCC
TCGGCCACGGCCATGATCCTGTGCTTCCAGACTCTGGGCGGCGCCATCTGGCTATCGGCTGCCCAGTCGGCCTTT
GTCAACAGGATGTTGCTCGCTGTGCCCAACACGGCCCCGGGCGTGGACCCGATGCGCGTCGTGGCCACCGGCGCC
GGCCAGCTGCACAAGGCCTTTAGGGAAGACGAGCTGGCAGGGGTGCTGGCCGCCTATCTCGACGGCATCAAGATA
GCCTTCGTGCTCTCGTGCGCCATCGTAGGCGCCGCGTTCGTGCTCGGATTGTTTCTGCCATGGAGGCGGCATGAC
ACGGCCGCTATTCAGAACAGTGCCGGGGCTGCATGA
Gene >Hirsu2|10375
ATGGACTCCAAAGGGACGCCAGAGACCCAGAGCGCCAAGGGGGCCGAGGCCATGCCACGGCCGGCCAACAGACTG
CGGCCCGGCATGAGGACGTCGACGATTGGGGCCGAGGAACTGTCCGTCTTCAGCCCTCTCGAGGTGACGCAGATC
ACCGCCTTGGACTTCGTCTTTCCCTCGCGGAGGGTAAGCTGGCGCCAGTCCGTCCTCAGCGACGGGGGACTGAGC
GCTCAGTTCCCGGCTCGGACGCCCAAGGGCCAGCTGCGTCCCGACTCCTATCTGGGCCACCAGAGCCGACTCGAG
CCCCTTCACGACCCAGACTCGGACGGCCAGTCCGGCTTGTCCCGACACTCAGGAGGGGAGGCCGACCTCGAGTTT
CTGGACTTGGAGGATGAGCAAGAGTATCCCACCGGGGCCAAACTGTTCATCATGATCGCCGCCCTGGTCTTTAGC
ATCTTCCTCATCGCTCTTGACATGGCAAGTCTTTCTCTAACCCCTGAACCAGTGCCGCGGACCGCCTTTTCCCGT
CGCTAACGCGATAGTCGTTCCTGTCAATGTCAACAGACCATCGTAGCCACGGCCATCCCAGCCATCACGGACGAG
TTCAAGGGCCTTCAGGACGTGGCGTGGTACGGAGCCGTCTTTTTCATGACCGCCGGCGGCTTTCAATCCACCTGG
GGCAAGACGTACAAGTTTTTCCCCCTCAAGATCGCCTTCTTGACCGCAATCTTCATCTTCGAGGTCGGCAGTCTG
ATATGCGGAGTGGCGCCGTCGTCGACCGTCTTCATCATTGGTCGGGCCATTGCAGGCATCGGGGCCGCAGGCGTC
GGCTCGGGCTCCTACACCATGGTTGCCTTCATAGCCAAGCCCAAGAGCAGGGCGGCCTACACCGGCCTCCTCGGG
GCTGTCTATGGCGTGGCCAGCGTTCTCGGCCCCCTCTTGGGCGGCGTCTTCTCCGGCGCCACTACTTGGAGATGG
TGAGTTGTCGTCCGCTTGGGTGCCCGTCGGAGTCGGTCGTCGAGGATGCGCGGCTGCTAGAGCTGACGGTGCACA
GGTGCTTCTATATCAATCTCCCGATAGGCGCCCTCCCAGTCGGCACAATCGTCTTCCTTTTCCACCCTCCCAAGG
CGGCCAAGCCGCAGGAGGCAACGCTCAAGGAGAAGCTTCTCCAGATGGACCCTCTCGGGACCAGCTTCATGATGG
GCGCCATCATCACCTATCTCATTGCCGTCAACTACGGCGGCCAGACGTACCCGTGGTCTTCGTCCATGGTCATCG
GTCTTCTCGTCGGCTCGGGCCTCCTCGCCATTGCCTTTGGGCTGTGCGAGTTTTGGCAGGACGAGCGGGCCATCG
TCATCCCCAGGCTGATCGGCAAGCGCGAAATCGGACTGTCGGCATTCTTCTCCATCATGCAGTCGGGGGCCTTCT
ACTGCATGATCTATTACCTGCCCATCTATTTCCAGGCCATCAGAGGTAGCGACCCCATCATGTCGGGCGTGCAGA
ACCTGCCGTTCATCCTGGCCGCCATGCTGGGCGCCCTCAGCGCCGGCATCTTCATCTCGAGAACGGGCATGTCGA
CCATAGTCATGGTCGGCGGCGCGGGCCTGGGGGTGCTTGGTAGCGGCCTGTGCTACACGCTTGACAGGAACACGT
CGACGGGCGCCTGGGTCGGATACCAGATCGTGGCCGGACTCGGCCTCGGCGGTGCCATGCAGATCCCCGTCATTG
TCTGCCAGGTCAGCGTCGAGCTGGTTGACCTGTCCTCGGCCACGGCCATGATCCTGTGCTTCCAGACTCTGGGCG
GCGCCATCTGGCTATCGGCTGCCCAGTCGGCCTTTGTCAACAGGATGTTGCTCGCTGTGCCCAACACGGCCCCGG
GCGTGGACCCGATGCGCGTCGTGGCCACCGGCGCCGGCCAGCTGCACAAGGCCTTTAGGGAAGACGAGCTGGCAG
GGGTGCTGGCCGCCTATCTCGACGGCATCAAGATAGCCTTCGTGCTCTCGTGCGCCATCGTAGGCGCCGCGTTCG
TGCTCGGATTGTTTCTGCCATGGAGGCGGCATGACACGGCCGCTATTCAGAACAGTGCCGGGGCTGCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail