Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10371
Gene name
LocationContig_83:41675..41950
Strand+
Gene length (bp)275
Transcript length (bp)201
Coding sequence length (bp)201
Protein length (aa) 67

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7647 0.4517 0.3547 0.0299 0.3568 0.0279 0.2334 0.1712 0.1782 0.0149

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2267
Ophiocordyceps australis map64 (Brazil) OphauB2|6005
Ophiocordyceps camponoti-floridani Ophcf2|06791
Ophiocordyceps camponoti-rufipedis Ophun1|6209
Ophiocordyceps kimflemingae Ophio5|6811
Ophiocordyceps subramaniannii Hirsu2|10371 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3539
Ophiocordyceps subramaniannii Hirsu2|5668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10371
MSQPSRITTILFDCDNTLVQSEPIGFEVSAEIANEVLARRGIDDVRFTGPQLQREFVGTTFQAMVR*
Coding >Hirsu2|10371
ATGTCCCAGCCGAGCCGCATCACGACCATCCTCTTCGACTGCGACAACACGCTGGTGCAGTCGGAGCCGATCGGG
TTCGAGGTCTCGGCCGAGATCGCCAACGAAGTGCTGGCCCGGCGCGGCATCGACGACGTGCGCTTCACGGGCCCG
CAGCTGCAGCGCGAGTTCGTCGGCACGACGTTCCAGGCCATGGTGCGGTAG
Transcript >Hirsu2|10371
ATGTCCCAGCCGAGCCGCATCACGACCATCCTCTTCGACTGCGACAACACGCTGGTGCAGTCGGAGCCGATCGGG
TTCGAGGTCTCGGCCGAGATCGCCAACGAAGTGCTGGCCCGGCGCGGCATCGACGACGTGCGCTTCACGGGCCCG
CAGCTGCAGCGCGAGTTCGTCGGCACGACGTTCCAGGCCATGGTGCGGTAG
Gene >Hirsu2|10371
ATGTCCCAGCCGAGCCGCATCACGACCATCCTCTTCGACTGCGACAACACGCTGGTGCAGTCGGAGCCGATCGGG
TTCGAGGTCTCGGCCGAGATCGCCAACGAAGTGCTGGCCCGGCGCGGCATCGACGACGTGCGCTTCACGGGCCCG
CAGCTGCAGCGCGAGTTCGTCGGCACGACGTTCCAGGCCATGGTGCGTATCTGCCCGTCCATGGTCCCCCCAAAC
TTCCCCCGGCTATGCGGAGGCGCGACGCGAGGTGAAAAGGCACAGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail