Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10369
Gene name
LocationContig_83:36350..37896
Strand+
Gene length (bp)1546
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02487 CLN3 CLN3 protein 3.8E-154 44 443

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HX89|BTN1_GIBZE Protein BTN1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BTN1 PE=3 SV=2 9 459 0.0E+00
sp|Q7SC45|BTN1_NEUCR Protein btn-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cln3 PE=3 SV=2 5 458 0.0E+00
sp|Q2GN49|BTN1_CHAGB Protein BTN1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BTN1 PE=3 SV=1 5 459 3.0E-176
sp|Q4X0S3|BTN1_ASPFU Protein btn1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btn1 PE=3 SV=1 1 456 2.0E-159
sp|Q6BZW3|BTN1_YARLI Protein BTN1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BTN1 PE=3 SV=1 45 455 8.0E-121
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HX89|BTN1_GIBZE Protein BTN1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BTN1 PE=3 SV=2 9 459 0.0E+00
sp|Q7SC45|BTN1_NEUCR Protein btn-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cln3 PE=3 SV=2 5 458 0.0E+00
sp|Q2GN49|BTN1_CHAGB Protein BTN1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BTN1 PE=3 SV=1 5 459 3.0E-176
sp|Q4X0S3|BTN1_ASPFU Protein btn1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btn1 PE=3 SV=1 1 456 2.0E-159
sp|Q6BZW3|BTN1_YARLI Protein BTN1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BTN1 PE=3 SV=1 45 455 8.0E-121
sp|Q6CLN9|BTN1_KLULA Protein BTN1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BTN1 PE=3 SV=1 39 455 7.0E-109
sp|Q758C3|BTN1_ASHGO Protein BTN1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BTN1 PE=3 SV=1 39 455 2.0E-108
sp|Q59LX9|BTN1_CANAL Protein BTN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BTN1 PE=3 SV=1 41 453 2.0E-104
sp|Q6BZ39|BTN1_DEBHA Protein BTN1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BTN1 PE=3 SV=2 42 453 4.0E-101
sp|Q6FPB6|BTN1_CANGA Protein BTN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BTN1 PE=3 SV=1 37 455 1.0E-96
sp|P47040|BTN1_YEAST Protein BTN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHC3 PE=3 SV=1 41 455 5.0E-85
sp|Q9US09|BTN1_SCHPO Protein btn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btn1 PE=1 SV=1 39 455 7.0E-81
sp|Q29611|CLN3_CANLF Battenin OS=Canis lupus familiaris GN=CLN3 PE=3 SV=1 41 443 6.0E-68
sp|Q4P4U7|BTN1_USTMA Protein BTN1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BTN1 PE=3 SV=2 36 455 1.0E-53
sp|Q13286|CLN3_HUMAN Battenin OS=Homo sapiens GN=CLN3 PE=1 SV=1 34 443 2.0E-51
sp|Q60HH0|CLN3_MACFA Battenin OS=Macaca fascicularis GN=CLN3 PE=2 SV=1 34 443 2.0E-49
sp|Q61124|CLN3_MOUSE Battenin OS=Mus musculus GN=Cln3 PE=1 SV=2 41 443 7.0E-43
sp|P0CM43|BTN1_CRYNB Protein BTN1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BTN1 PE=3 SV=1 36 454 2.0E-40
sp|P0CM42|BTN1_CRYNJ Protein BTN1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BTN1 PE=3 SV=1 36 454 4.0E-40
sp|Q54F25|CLN3_DICDI Battenin OS=Dictyostelium discoideum GN=cln3 PE=3 SV=1 44 438 7.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 75 97 22
3 104 123 19
4 133 155 22
5 160 182 22
6 192 211 19
7 284 302 18
8 322 339 17
9 352 374 22
10 378 400 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10369
MTPSSRFSSSSALLPLPGAASSSWALCRARLGALLRHADTKILVAFWLLGLINNLLYVAILSAAQDLVGSLPKGI
VLLADVMPSFGLKLVAPYFIHAVPYRIRVPVFIALASAGMLAVALSPAEQSVGFKMAGIVMASLSSGGGELTFLS
LLHFYGRAGLIGWSSGTGASGLVGAGLYEILTEWCGFSVRDSLLFCACLPVLMFVSFFFVLPPEPMMLAHGRKSY
EAVPNQETADAPVLDSNSDEPSSALLAPVSPPSNVTRSTHASASMSQSLTANLRRAKSLFMPYMVPLFLVYVAEY
TINQGVSPTLLFPVESSPFRHFRSFYPFYGFLYQLGVFISRSSMSLVRIHNLYLPSVLQLANLAFLTLHALFYFI
PSVYLVFVIIFWEGLLGGCVYVNCFAEILENVPPEDREFSLGATSVSDSAGICTAGLVSIVLETNLCEYQVAHGR
RWCRMIEAQRA*
Coding >Hirsu2|10369
ATGACGCCCTCCAGCCGGTTCTCCTCCTCCTCGGCGCTGCTGCCCCTTCCCGGCGCCGCCTCCTCCTCCTGGGCT
CTGTGCCGCGCGCGCCTCGGCGCCCTGCTGCGCCATGCCGATACCAAGATTCTCGTTGCTTTTTGGCTCCTCGGC
CTGATCAACAATCTGCTCTACGTCGCCATCCTGTCTGCCGCCCAAGATCTGGTCGGCTCCCTCCCCAAGGGCATC
GTTCTACTCGCCGACGTCATGCCGTCCTTTGGCCTCAAGCTCGTCGCCCCCTACTTCATCCACGCCGTTCCGTAC
CGGATCCGTGTCCCCGTCTTCATCGCCCTGGCCTCGGCCGGCATGCTCGCCGTCGCCTTGTCGCCCGCCGAGCAG
TCGGTAGGCTTCAAAATGGCCGGCATCGTCATGGCCAGCCTCAGCAGTGGCGGCGGCGAGCTCACCTTCCTTTCT
CTGCTCCACTTCTACGGCCGAGCTGGCCTGATCGGCTGGAGCTCGGGCACCGGAGCGTCTGGCCTCGTCGGCGCT
GGCCTGTACGAGATACTGACCGAGTGGTGCGGCTTCAGTGTCCGTGACAGCCTGCTCTTTTGCGCCTGCCTGCCC
GTCCTCATGTTTGTCAGCTTCTTCTTCGTCCTGCCGCCGGAACCAATGATGCTTGCCCACGGTCGGAAGAGCTAC
GAGGCCGTGCCGAACCAGGAGACGGCAGATGCCCCCGTCCTTGACAGCAATTCGGACGAGCCGAGTTCGGCCTTG
CTCGCCCCCGTCTCTCCGCCCAGCAACGTTACCAGGTCCACCCACGCCAGCGCGTCCATGTCGCAATCGCTGACG
GCCAACTTAAGACGGGCAAAGTCGCTGTTTATGCCCTACATGGTTCCACTGTTCCTCGTCTACGTTGCCGAGTAC
ACCATCAACCAGGGCGTCTCGCCGACTCTGCTCTTCCCGGTCGAGTCGTCGCCCTTCCGCCATTTCCGTAGCTTC
TACCCCTTCTACGGCTTCCTCTATCAGCTCGGCGTCTTCATCTCCCGCTCGTCCATGTCCCTAGTTCGCATCCAC
AACCTTTACCTCCCGTCCGTTCTCCAGCTCGCCAACTTGGCGTTCCTCACCCTACATGCCCTCTTTTACTTCATC
CCATCCGTCTACCTCGTCTTCGTCATCATCTTCTGGGAGGGCCTCCTCGGGGGCTGCGTCTACGTCAACTGCTTC
GCCGAGATTCTGGAGAACGTGCCGCCCGAGGACCGCGAGTTCAGCCTGGGTGCCACCTCTGTGAGTGACAGCGCC
GGCATCTGCACCGCAGGCCTGGTGAGCATCGTCCTGGAAACGAACCTGTGCGAATACCAAGTCGCCCACGGAAGG
AGGTGGTGTCGCATGATTGAGGCCCAACGTGCTTGA
Transcript >Hirsu2|10369
ATGACGCCCTCCAGCCGGTTCTCCTCCTCCTCGGCGCTGCTGCCCCTTCCCGGCGCCGCCTCCTCCTCCTGGGCT
CTGTGCCGCGCGCGCCTCGGCGCCCTGCTGCGCCATGCCGATACCAAGATTCTCGTTGCTTTTTGGCTCCTCGGC
CTGATCAACAATCTGCTCTACGTCGCCATCCTGTCTGCCGCCCAAGATCTGGTCGGCTCCCTCCCCAAGGGCATC
GTTCTACTCGCCGACGTCATGCCGTCCTTTGGCCTCAAGCTCGTCGCCCCCTACTTCATCCACGCCGTTCCGTAC
CGGATCCGTGTCCCCGTCTTCATCGCCCTGGCCTCGGCCGGCATGCTCGCCGTCGCCTTGTCGCCCGCCGAGCAG
TCGGTAGGCTTCAAAATGGCCGGCATCGTCATGGCCAGCCTCAGCAGTGGCGGCGGCGAGCTCACCTTCCTTTCT
CTGCTCCACTTCTACGGCCGAGCTGGCCTGATCGGCTGGAGCTCGGGCACCGGAGCGTCTGGCCTCGTCGGCGCT
GGCCTGTACGAGATACTGACCGAGTGGTGCGGCTTCAGTGTCCGTGACAGCCTGCTCTTTTGCGCCTGCCTGCCC
GTCCTCATGTTTGTCAGCTTCTTCTTCGTCCTGCCGCCGGAACCAATGATGCTTGCCCACGGTCGGAAGAGCTAC
GAGGCCGTGCCGAACCAGGAGACGGCAGATGCCCCCGTCCTTGACAGCAATTCGGACGAGCCGAGTTCGGCCTTG
CTCGCCCCCGTCTCTCCGCCCAGCAACGTTACCAGGTCCACCCACGCCAGCGCGTCCATGTCGCAATCGCTGACG
GCCAACTTAAGACGGGCAAAGTCGCTGTTTATGCCCTACATGGTTCCACTGTTCCTCGTCTACGTTGCCGAGTAC
ACCATCAACCAGGGCGTCTCGCCGACTCTGCTCTTCCCGGTCGAGTCGTCGCCCTTCCGCCATTTCCGTAGCTTC
TACCCCTTCTACGGCTTCCTCTATCAGCTCGGCGTCTTCATCTCCCGCTCGTCCATGTCCCTAGTTCGCATCCAC
AACCTTTACCTCCCGTCCGTTCTCCAGCTCGCCAACTTGGCGTTCCTCACCCTACATGCCCTCTTTTACTTCATC
CCATCCGTCTACCTCGTCTTCGTCATCATCTTCTGGGAGGGCCTCCTCGGGGGCTGCGTCTACGTCAACTGCTTC
GCCGAGATTCTGGAGAACGTGCCGCCCGAGGACCGCGAGTTCAGCCTGGGTGCCACCTCTGTGAGTGACAGCGCC
GGCATCTGCACCGCAGGCCTGGTGAGCATCGTCCTGGAAACGAACCTGTGCGAATACCAAGTCGCCCACGGAAGG
AGGTGGTGTCGCATGATTGAGGCCCAACGTGCTTGA
Gene >Hirsu2|10369
ATGACGCCCTCCAGCCGGTTCTCCTCCTCCTCGGCGCTGCTGCCCCTTCCCGGCGCCGCCTCCTCCTCCTGGGCT
CTGTGCCGCGCGCGCCTCGGCGCCCTGCTGCGCCATGCCGATACCAAGATTCTCGTTGCTTTTTGGCTCCTCGGT
GAGTGCCGTCACGGGCCTTGCCTTGCTTTTCTGTGCTTTGCTTTAATGAGCTCGGCTTTAATCAGATCTGCTCTG
CTCTGCTCTGCTTCGCCTCGTGTTCGGCCTGATTGATAGACGCTCCTTGGCTGACCTGGCTCCATCTCCATCTCG
CCTGCTAGGCCTGATCAACAATCTGCTCTACGTCGCCATCCTGTCTGCCGCCCAAGATCTGGTCGGCTCCCTCCC
CAAGGGCATCGTTCTACTCGCCGACGTCATGCCGTCCTTTGGCCTCAAGCTCGTCGCCCCCTACTTCATCCACGC
CGTTCCGTACCGGATCCGTGTCCCCGTCTTCATCGCCCTGGCCTCGGCCGGCATGCTCGCCGTCGCCTTGTCGCC
CGCCGAGCAGTCGGTAGGCTTCAAAATGGCCGGCATCGTCATGGCCAGCCTCAGCAGTGGCGGCGGCGAGCTCAC
CTTCCTTTCTCTGCTCCACTTCTACGGCCGAGCTGGCCTGATCGGCTGGAGCTCGGGCACCGGAGCGTCTGGCCT
CGTCGGCGCTGGCCTGTACGAGATACTGACCGAGTGGTGCGGCTTCAGTGTCCGTGACAGCCTGCTCTTTTGCGC
CTGCCTGCCCGTCCTCATGTTTGTCAGCTTCTTCTTCGTCCTGCCGCCGGAACCAATGATGCTTGCCCACGGTCG
GAAGAGCTACGAGGCCGTGCCGAACCAGGAGACGGCAGATGCCCCCGTCCTTGACAGCAATTCGGACGAGCCGAG
TTCGGCCTTGCTCGCCCCCGTCTCTCCGCCCAGCAACGTTACCAGGTCCACCCACGCCAGCGCGTCCATGTCGCA
ATCGCTGACGGCCAACTTAAGACGGGCAAAGTCGCTGTTTATGCCCTACATGGTTCCACTGTTCCTCGTCTACGT
TGCCGAGTACACCATCAACCAGGGCGTCTCGCCGACTCTGCTCTTCCCGGTCGAGTCGTCGCCCTTCCGCCATTT
CCGTAGCTTCTACCCCTTCTACGGCTTCCTCTATCAGCTCGGCGTCTTCATCTCCCGCTCGTCCATGTCCCTAGT
TCGCATCCACAACCTTTACCTCCCGTCCGTTCTCCAGCTCGCCAACTTGGCGTTCCTCACCCTACATGCCCTCTT
TTACTTCATCCCATCCGTCTACCTCGTCTTCGTCATCATCTTCTGGGAGGGCCTCCTCGGGGGCTGCGTCTACGT
CAACTGCTTCGCCGAGATTCTGGAGAACGTGCCGCCCGAGGACCGCGAGTTCAGCCTGGGTGCCACCTCTGTGAG
TGACAGCGCCGGCATCTGCACCGCAGGCCTGGTGAGCATCGTCCTGGAAACGAACCTGTGCGAATACCAAGTCGC
CCACGGAAGGAGGTGGTGTCGCATGATTGAGGCCCAACGTGCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail