Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10360
Gene name
LocationContig_83:15259..16753
Strand-
Gene length (bp)1494
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04678 MCU Mitochondrial calcium uniporter 1.2E-23 223 345

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8VYR0|MCU5_ARATH Calcium uniporter protein 5, mitochondrial OS=Arabidopsis thaliana GN=At1g57610 PE=2 SV=1 237 345 6.0E-13
sp|F4I111|MCU6_ARATH Calcium uniporter protein 6, mitochondrial OS=Arabidopsis thaliana GN=At1g09575 PE=2 SV=1 233 366 7.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 262 281 19
2 291 310 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10360
MLAPVGETTQTATQDQEHRTTAAKSQQRKVYDRPWLRESSNALPKATSQDPAGGDATKGRLLTTPTRLLKLILPM
PFHPEQEHINATEEERRQWSEQKIEPLALLVHPQQPLSYLELLIQAEIPPVRQDGGRVRLPEVVFRAESGGDEAG
SGSAEEAPGGNVAPYSGLGREGPSKRQAKWVRWSSSTEVGDFIRDAARGREFAIDIEGLEQELRVAVPSFKDRTY
YMRMRLRKMSRQIDRMSRVKKECDLLAHQGAYRLAKGGFAALAGWWGIVYYVTFHTDMGWDLVEPVTYLAGLTTI
MGGYLWFLFISRDLSYKAAMNVTVTRRQNALYQERGFDPQKWEQLVHEANMLRREVRLAATEYDVEWDEMADLGG
EEVRQALEQESKDGEEKKKKKKKTKRHDGDEEEENEEDEDDDGEDDGHHGGDKGKPSGRHGGGKDASAKTSKRG*
Coding >Hirsu2|10360
ATGTTGGCGCCTGTCGGAGAAACGACGCAGACGGCGACGCAGGACCAAGAGCATCGGACGACGGCGGCCAAGAGC
CAGCAGAGAAAAGTGTACGACCGGCCGTGGCTGCGCGAGAGCAGCAATGCCCTGCCCAAGGCCACGTCGCAAGAC
CCGGCGGGCGGCGACGCCACCAAAGGACGGCTGTTGACGACGCCGACGCGGCTGCTCAAGCTCATCCTCCCGATG
CCCTTCCACCCCGAGCAGGAGCACATCAACGCGACGGAGGAGGAGCGGCGGCAGTGGAGCGAGCAGAAGATCGAA
CCGCTGGCCCTCCTCGTCCACCCACAACAGCCGCTCTCGTACCTGGAGCTGCTGATACAGGCCGAGATACCGCCG
GTGCGGCAGGACGGCGGGCGGGTGCGGCTGCCGGAGGTCGTCTTCCGGGCCGAGTCGGGGGGCGACGAGGCAGGC
TCCGGGTCTGCCGAGGAGGCTCCGGGGGGCAACGTGGCGCCGTACTCGGGCCTCGGGCGCGAGGGCCCGAGCAAG
AGGCAGGCGAAATGGGTGCGATGGAGCAGCAGCACCGAGGTGGGCGACTTCATCCGCGACGCGGCGCGGGGCCGC
GAGTTCGCCATCGACATCGAGGGCCTGGAGCAGGAGCTACGGGTGGCAGTGCCGAGCTTCAAGGACCGGACGTAC
TACATGCGGATGCGGCTGCGCAAGATGTCGCGGCAGATCGACCGCATGTCGCGCGTCAAGAAGGAGTGCGACCTG
CTGGCGCACCAGGGCGCGTACCGGCTGGCCAAGGGCGGCTTCGCGGCGCTGGCCGGCTGGTGGGGGATCGTCTAC
TACGTCACCTTCCACACCGACATGGGCTGGGACCTGGTCGAGCCGGTGACGTACCTGGCCGGCCTGACGACCATC
ATGGGCGGCTACCTCTGGTTCCTCTTCATCAGCCGCGACCTGAGCTACAAGGCGGCCATGAACGTGACGGTGACG
CGCCGCCAGAACGCCCTCTACCAGGAGCGCGGCTTCGACCCGCAGAAGTGGGAGCAGCTGGTGCACGAGGCCAAC
ATGCTGCGGCGCGAGGTGCGCTTGGCCGCGACCGAGTACGACGTCGAGTGGGACGAGATGGCCGACCTGGGCGGC
GAGGAGGTGCGCCAGGCGCTCGAGCAGGAGAGCAAGGACGGGGAGGAGAAGAAGAAGAAGAAGAAGAAGACGAAG
CGGCACGACGGCGACGAGGAGGAGGAGAATGAGGAGGATGAGGACGACGACGGCGAAGACGACGGGCACCACGGC
GGCGACAAGGGCAAGCCGAGCGGGCGCCATGGCGGAGGCAAGGACGCGTCGGCGAAGACGAGCAAGCGAGGATGA
Transcript >Hirsu2|10360
ATGTTGGCGCCTGTCGGAGAAACGACGCAGACGGCGACGCAGGACCAAGAGCATCGGACGACGGCGGCCAAGAGC
CAGCAGAGAAAAGTGTACGACCGGCCGTGGCTGCGCGAGAGCAGCAATGCCCTGCCCAAGGCCACGTCGCAAGAC
CCGGCGGGCGGCGACGCCACCAAAGGACGGCTGTTGACGACGCCGACGCGGCTGCTCAAGCTCATCCTCCCGATG
CCCTTCCACCCCGAGCAGGAGCACATCAACGCGACGGAGGAGGAGCGGCGGCAGTGGAGCGAGCAGAAGATCGAA
CCGCTGGCCCTCCTCGTCCACCCACAACAGCCGCTCTCGTACCTGGAGCTGCTGATACAGGCCGAGATACCGCCG
GTGCGGCAGGACGGCGGGCGGGTGCGGCTGCCGGAGGTCGTCTTCCGGGCCGAGTCGGGGGGCGACGAGGCAGGC
TCCGGGTCTGCCGAGGAGGCTCCGGGGGGCAACGTGGCGCCGTACTCGGGCCTCGGGCGCGAGGGCCCGAGCAAG
AGGCAGGCGAAATGGGTGCGATGGAGCAGCAGCACCGAGGTGGGCGACTTCATCCGCGACGCGGCGCGGGGCCGC
GAGTTCGCCATCGACATCGAGGGCCTGGAGCAGGAGCTACGGGTGGCAGTGCCGAGCTTCAAGGACCGGACGTAC
TACATGCGGATGCGGCTGCGCAAGATGTCGCGGCAGATCGACCGCATGTCGCGCGTCAAGAAGGAGTGCGACCTG
CTGGCGCACCAGGGCGCGTACCGGCTGGCCAAGGGCGGCTTCGCGGCGCTGGCCGGCTGGTGGGGGATCGTCTAC
TACGTCACCTTCCACACCGACATGGGCTGGGACCTGGTCGAGCCGGTGACGTACCTGGCCGGCCTGACGACCATC
ATGGGCGGCTACCTCTGGTTCCTCTTCATCAGCCGCGACCTGAGCTACAAGGCGGCCATGAACGTGACGGTGACG
CGCCGCCAGAACGCCCTCTACCAGGAGCGCGGCTTCGACCCGCAGAAGTGGGAGCAGCTGGTGCACGAGGCCAAC
ATGCTGCGGCGCGAGGTGCGCTTGGCCGCGACCGAGTACGACGTCGAGTGGGACGAGATGGCCGACCTGGGCGGC
GAGGAGGTGCGCCAGGCGCTCGAGCAGGAGAGCAAGGACGGGGAGGAGAAGAAGAAGAAGAAGAAGAAGACGAAG
CGGCACGACGGCGACGAGGAGGAGGAGAATGAGGAGGATGAGGACGACGACGGCGAAGACGACGGGCACCACGGC
GGCGACAAGGGCAAGCCGAGCGGGCGCCATGGCGGAGGCAAGGACGCGTCGGCGAAGACGAGCAAGCGAGGATGA
Gene >Hirsu2|10360
ATGTTGGCGCCTGTCGGTGGGTTCGCGAGGTCCTTTTCAACCTCTCCTTTTACTTTGCGAGACCACAATGCCACC
TCGGCAGGAGAAACGACGCAGACGGCGACGCAGGACCAAGAGCATCGGACGACGGCGGCCAAGAGCCAGCAGAGA
AAAGTGTACGACCGGCCGTGGCTGCGCGAGAGCAGCAATGCCCTGCCCAAGGCCACGTCGCAAGACCCGGCGGGC
GGCGACGCCACCAAAGGTCGGTAGCTGCCCCGGCCGATGCAGAGCAGAGCAGGATAGAGCGATGACGCTGACACG
GCCGCATCACCCACTCCAGGACGGCTGTTGACGACGCCGACGCGGCTGCTCAAGCTCATCCTCCCGATGCCCTTC
CACCCCGAGCAGGAGCACATCAACGCGACGGAGGAGGAGCGGCGGCAGTGGAGCGAGCAGAAGATCGAACCGCTG
GCCCTCCTCGTCCACCCACAACAGCCGCTCTCGTACCTGGAGCTGCTGATACAGGCCGAGATACCGCCGGTGCGG
CAGGACGGCGGGCGGGTGCGGCTGCCGGAGGTCGTCTTCCGGGCCGAGTCGGGGGGCGACGAGGCAGGCTCCGGG
TCTGCCGAGGAGGCTCCGGGGGGCAACGTGGCGCCGTACTCGGGCCTCGGGCGCGAGGGCCCGAGCAAGAGGCAG
GCGAAATGGGTGCGATGGAGCAGCAGCACCGAGGTGGGCGACTTCATCCGCGACGCGGCGCGGGGCCGCGAGTTC
GCCATCGACATCGAGGGCCTGGAGCAGGAGCTACGGGTGGCAGTGCCGAGCTTCAAGGACCGGACGTACTACATG
CGGATGCGGCTGCGCAAGATGTCGCGGCAGATCGACCGCATGTCGCGCGTCAAGAAGGAGTGCGACCTGCTGGCG
CACCAGGGCGCGTACCGGCTGGCCAAGGGCGGCTTCGCGGCGCTGGCCGGCTGGTGGGGGATCGTCTACTACGTC
ACCTTCCACACCGACATGGGCTGGGACCTGGTCGAGCCGGTGACGTACCTGGCCGGCCTGACGACCATCATGGGC
GGCTACCTCTGGTTCCTCTTCATCAGCCGCGACCTGAGCTACAAGGCGGCCATGAACGTGACGGTGACGCGCCGC
CAGAACGCCCTCTACCAGGAGCGCGGCTTCGACCCGCAGAAGTGGGAGCAGCTGGTGCACGAGGCCAACATGCTG
CGGCGCGAGGTGCGCTTGGCCGCGACCGAGTACGACGTCGAGTGGGACGAGATGGCCGACCTGGGCGGCGAGGAG
GTGCGCCAGGCGCTCGAGCAGGAGAGCAAGGACGGGGAGGAGAAGAAGAAGAAGAAGAAGAAGACGAAGCGGCAC
GACGGCGACGAGGAGGAGGAGAATGAGGAGGATGAGGACGACGACGGCGAAGACGACGGGCACCACGGCGGCGAC
AAGGGCAAGCCGAGCGGGCGCCATGGCGGAGGCAAGGACGCGTCGGCGAAGACGAGCAAGCGAGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail