Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10359
Gene name
LocationContig_83:12980..14458
Strand+
Gene length (bp)1478
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.1E-10 109 279
PF00083 Sugar_tr Sugar (and other) transporter 3.5E-06 136 276

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 74 289 5.0E-18
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 58 286 4.0E-12

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 106 128 22
2 138 160 22
3 167 189 22
4 199 216 17
5 229 251 22
6 256 278 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10359
MAGDIVNDKPVAIAQPPLAHPHEPSLRSLASTDTYRPTTAASWPPPVMASPRSPSFASSSLFSQPKCIKYGSGRH
ADVELIPQPSDDPDDPLNWPRWRKDLNLASLLATVGLVGAMKTAFVTTGGVMASRYGVEYTTVAALTSVPILLSV
LAGLGSSVAAKLWGKRPLYLASAVPLLVGSVWAAAAAADSYAACMAARVLQGLGWGAFDVLVLGSIQDTYFEHER
DLPVSLYNIFTIATTWGSPLVGGLASSSGGSFAAQFRVVSALHIVSLPLLVLGAPETAFDRTMAGGLVPPPLFSV
GKTVSDVGGGRASPWLSSSSSSSSSSSTGTSCTSSVCSTVVQPIGQVDHLRRAHPLAVLEFFFPALLFSLLSMQR
*
Coding >Hirsu2|10359
ATGGCCGGGGACATCGTCAACGACAAGCCCGTGGCCATCGCCCAGCCCCCGCTGGCTCACCCGCACGAGCCGTCG
CTGAGATCGCTGGCTTCCACCGACACCTACCGCCCGACGACGGCGGCGTCATGGCCGCCTCCCGTCATGGCCTCC
CCCCGGAGCCCGTCCTTCGCCTCCTCCTCCCTGTTCAGCCAGCCCAAGTGCATCAAGTACGGCAGCGGCAGGCAC
GCCGACGTCGAGCTGATACCGCAGCCGAGCGACGACCCGGATGATCCCCTGAACTGGCCGCGGTGGCGCAAGGAC
CTGAACCTGGCCTCTCTCCTCGCCACCGTCGGCCTGGTGGGCGCCATGAAGACGGCCTTTGTGACGACGGGCGGC
GTCATGGCCAGCCGGTACGGCGTCGAGTACACGACCGTGGCCGCCCTCACCTCGGTCCCCATCCTGCTGTCCGTC
CTGGCCGGCCTCGGCAGCTCCGTCGCCGCCAAGCTCTGGGGCAAGCGCCCGCTGTACCTGGCGTCGGCCGTGCCG
CTGCTCGTCGGCTCCGTCTGGGCCGCCGCCGCCGCCGCCGACAGCTACGCCGCCTGCATGGCCGCCCGCGTCCTC
CAGGGCCTGGGCTGGGGCGCCTTCGACGTCTTGGTCTTGGGGTCTATCCAAGACACGTACTTTGAGCACGAGCGC
GACCTGCCCGTATCGCTGTACAACATCTTCACCATCGCCACGACGTGGGGGTCCCCCCTGGTCGGCGGGCTGGCC
TCGAGCAGCGGCGGCTCGTTCGCGGCGCAGTTCCGCGTCGTCAGCGCGCTGCACATCGTCTCGCTGCCGCTGCTG
GTGCTGGGCGCGCCCGAGACGGCCTTCGACCGGACCATGGCCGGCGGGCTCGTGCCGCCGCCGCTGTTTAGCGTG
GGCAAGACGGTCTCGGACGTCGGCGGCGGCCGCGCGTCGCCGTGGTTATCGTCGTCGTCGTCGTCGTCGTCGTCG
TCGTCCACCGGCACCTCGTGCACCTCCTCCGTGTGCAGCACCGTCGTCCAGCCGATCGGGCAGGTGGATCATCTG
CGACGGGCCCATCCTCTGGCCGTCCTGGAATTCTTCTTCCCGGCCCTGCTCTTCTCTCTCTTGTCGATGCAGCGG
TGA
Transcript >Hirsu2|10359
ATGGCCGGGGACATCGTCAACGACAAGCCCGTGGCCATCGCCCAGCCCCCGCTGGCTCACCCGCACGAGCCGTCG
CTGAGATCGCTGGCTTCCACCGACACCTACCGCCCGACGACGGCGGCGTCATGGCCGCCTCCCGTCATGGCCTCC
CCCCGGAGCCCGTCCTTCGCCTCCTCCTCCCTGTTCAGCCAGCCCAAGTGCATCAAGTACGGCAGCGGCAGGCAC
GCCGACGTCGAGCTGATACCGCAGCCGAGCGACGACCCGGATGATCCCCTGAACTGGCCGCGGTGGCGCAAGGAC
CTGAACCTGGCCTCTCTCCTCGCCACCGTCGGCCTGGTGGGCGCCATGAAGACGGCCTTTGTGACGACGGGCGGC
GTCATGGCCAGCCGGTACGGCGTCGAGTACACGACCGTGGCCGCCCTCACCTCGGTCCCCATCCTGCTGTCCGTC
CTGGCCGGCCTCGGCAGCTCCGTCGCCGCCAAGCTCTGGGGCAAGCGCCCGCTGTACCTGGCGTCGGCCGTGCCG
CTGCTCGTCGGCTCCGTCTGGGCCGCCGCCGCCGCCGCCGACAGCTACGCCGCCTGCATGGCCGCCCGCGTCCTC
CAGGGCCTGGGCTGGGGCGCCTTCGACGTCTTGGTCTTGGGGTCTATCCAAGACACGTACTTTGAGCACGAGCGC
GACCTGCCCGTATCGCTGTACAACATCTTCACCATCGCCACGACGTGGGGGTCCCCCCTGGTCGGCGGGCTGGCC
TCGAGCAGCGGCGGCTCGTTCGCGGCGCAGTTCCGCGTCGTCAGCGCGCTGCACATCGTCTCGCTGCCGCTGCTG
GTGCTGGGCGCGCCCGAGACGGCCTTCGACCGGACCATGGCCGGCGGGCTCGTGCCGCCGCCGCTGTTTAGCGTG
GGCAAGACGGTCTCGGACGTCGGCGGCGGCCGCGCGTCGCCGTGGTTATCGTCGTCGTCGTCGTCGTCGTCGTCG
TCGTCCACCGGCACCTCGTGCACCTCCTCCGTGTGCAGCACCGTCGTCCAGCCGATCGGGCAGGTGGATCATCTG
CGACGGGCCCATCCTCTGGCCGTCCTGGAATTCTTCTTCCCGGCCCTGCTCTTCTCTCTCTTGTCGATGCAGCGG
TGA
Gene >Hirsu2|10359
ATGGCCGGGGACATCGTCAACGACAAGCCCGTGGCCATCGCCCAGCCCCCGCTGGCTCACCCGCACGAGCCGTCG
CTGAGATCGCTGGCTTCCACCGACACCTACCGCCCGACGACGGCGGCGTCATGGCCGCCTCCCGTCATGGCCTCC
CCCCGGAGCCCGTCCTTCGCCTCCTCCTCCCTGTTCAGCCAGCCCAAGTGCATCAAGTACGGCAGCGGCAGGCAC
GCCGACGTCGAGCTGATACCGCAGCCGAGCGACGACCCGGATGATCCCCTGGTGCGTCCCCGCTCCCAAGCTGTC
CTGTCGTCCCTCCCGGTCTTGGACGGTGGAAAGACGGCAGCGGAGAAGGAATAAGAACGAGGAGGAGCTTACGCT
TTTTTTTTTCTTCCGCGAGCAGAACTGGCCGCGGTGGCGCAAGGACCTGAACCTGGCCTCTCTCCTCGCCACCGT
CGGCCTGGTGGGCGCCATGAAGACGGCCTTTGTGACGACGGGCGGCGTCATGGCCAGCCGGTACGGCGTCGAGTA
CACGACCGTGGCCGCCCTCACCTCGGTCCCCATCCTGCTGTCCGTCCTGGCCGGCCTCGGCAGCTCCGTCGCCGC
CAAGCTCTGGGGCAAGCGCCCGCTGTACCTGGCGTCGGCCGTGCCGCTGCTCGTCGGCTCCGTCTGGGCCGCCGC
CGCCGCCGCCGACAGCTACGCCGCCTGCATGGCCGCCCGCGTCCTCCAGGGCCTGGGCTGGGGCGCCTTCGACGT
CTTGGTCTTGGGGTCTATCCAAGACACGTACTTTGTGAGTCTCTCTCTCGAAAAGTTCCCGTTTCTATTCTCTCT
CTCCCCCCCTCTCTTGTGTGCGCGAGCCTCTGCCTGAGCGCCCGGCGGCAAATGCAACAGGACTGACGACGGAGA
GGGGGGAAAACGGTGGCGGCGCCATAGGAGCACGAGCGCGACCTGCCCGTATCGCTGTACAACATCTTCACCATC
GCCACGACGTGGGGGTCCCCCCTGGTCGGCGGGCTGGCCTCGAGCAGCGGCGGCTCGTTCGCGGCGCAGTTCCGC
GTCGTCAGCGCGCTGCACATCGTCTCGCTGCCGCTGCTGGTGCTGGGCGCGCCCGAGACGGCCTTCGACCGGACC
ATGGCCGGCGGGCTCGTGCCGCCGCCGCTGTTTAGCGTGGGCAAGACGGTCTCGGACGTCGGCGGCGGCCGCGCG
TCGCCGTGGTTATCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCCACCGGCACCTCGTGCACCTCCTCCGTGTGC
AGCACCGTCGTCCAGCCGATCGGGTACGGGTGCTTGTCCGTGTTGAGCTCGTGGCTGCGGAAGCTGAGGCCGGCG
AAGACGGGCTTGACGATGAAGGTCTGCCCGTCAGGCAGGTGGATCATCTGCGACGGGCCCATCCTCTGGCCGTCC
TGGAATTCTTCTTCCCGGCCCTGCTCTTCTCTCTCTTGTCGATGCAGCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail