Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10356
Gene name
LocationContig_83:6399..8959
Strand+
Gene length (bp)2560
Transcript length (bp)2355
Coding sequence length (bp)2355
Protein length (aa) 785

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 2.0E-102 83 471
PF01740 STAS STAS domain 5.1E-06 556 670

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23622|CYS14_NEUCR Sulfate permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-14 PE=2 SV=3 39 775 0.0E+00
sp|O74377|SULH1_SCHPO Probable sulfate permease C3H7.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.02 PE=3 SV=1 40 779 5.0E-152
sp|Q9URY8|SULH2_SCHPO Probable sulfate permease C869.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.05c PE=1 SV=1 36 769 2.0E-150
sp|P38359|SUL1_YEAST Sulfate permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL1 PE=1 SV=2 39 767 1.0E-131
sp|Q12325|SUL2_YEAST Sulfate permease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL2 PE=1 SV=1 57 681 7.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23622|CYS14_NEUCR Sulfate permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-14 PE=2 SV=3 39 775 0.0E+00
sp|O74377|SULH1_SCHPO Probable sulfate permease C3H7.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.02 PE=3 SV=1 40 779 5.0E-152
sp|Q9URY8|SULH2_SCHPO Probable sulfate permease C869.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.05c PE=1 SV=1 36 769 2.0E-150
sp|P38359|SUL1_YEAST Sulfate permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL1 PE=1 SV=2 39 767 1.0E-131
sp|Q12325|SUL2_YEAST Sulfate permease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL2 PE=1 SV=1 57 681 7.0E-124
sp|P53392|SUT2_STYHA High affinity sulfate transporter 2 OS=Stylosanthes hamata GN=ST2 PE=2 SV=1 36 685 1.0E-57
sp|P53391|SUT1_STYHA High affinity sulfate transporter 1 OS=Stylosanthes hamata GN=ST1 PE=2 SV=1 36 659 4.0E-55
sp|Q9FY46|SUT41_ARATH Sulfate transporter 4.1, chloroplastic OS=Arabidopsis thaliana GN=SULTR4;1 PE=1 SV=1 50 511 1.0E-53
sp|Q9SV13|SUT31_ARATH Sulfate transporter 3.1 OS=Arabidopsis thaliana GN=SULTR3;1 PE=2 SV=1 65 654 2.0E-51
sp|Q8GYH8|SUT42_ARATH Probable sulfate transporter 4.2 OS=Arabidopsis thaliana GN=SULTR4;2 PE=2 SV=2 63 511 2.0E-50
sp|Q58DD2|S2611_BOVIN Sodium-independent sulfate anion transporter OS=Bos taurus GN=SLC26A11 PE=2 SV=1 61 505 4.0E-48
sp|A8J6J0|SULT2_CHLRE Proton/sulfate cotransporter 2 OS=Chlamydomonas reinhardtii GN=SULTR2 PE=2 SV=1 62 511 1.0E-47
sp|Q9SAY1|SUT11_ARATH Sulfate transporter 1.1 OS=Arabidopsis thaliana GN=SULTR1;1 PE=1 SV=2 65 659 2.0E-47
sp|Q9LW86|SUT34_ARATH Probable sulfate transporter 3.4 OS=Arabidopsis thaliana GN=SULTR3;4 PE=2 SV=1 65 654 4.0E-46
sp|P92946|SUT22_ARATH Sulfate transporter 2.2 OS=Arabidopsis thaliana GN=SULTR2;2 PE=1 SV=3 65 520 8.0E-45
sp|O04722|SUT21_ARATH Sulfate transporter 2.1 OS=Arabidopsis thaliana GN=SULTR2;1 PE=2 SV=1 55 652 1.0E-43
sp|Q9SXS2|SUT33_ARATH Probable sulfate transporter 3.3 OS=Arabidopsis thaliana GN=SULTR3;3 PE=2 SV=2 55 541 7.0E-43
sp|Q9H2B4|S26A1_HUMAN Sulfate anion transporter 1 OS=Homo sapiens GN=SLC26A1 PE=1 SV=2 65 648 1.0E-42
sp|Q8CIW6|S26A6_MOUSE Solute carrier family 26 member 6 OS=Mus musculus GN=Slc26a6 PE=1 SV=2 49 596 3.0E-42
sp|P40879|S26A3_HUMAN Chloride anion exchanger OS=Homo sapiens GN=SLC26A3 PE=1 SV=1 67 643 5.0E-42
sp|P53393|SUT3_STYHA Low affinity sulfate transporter 3 OS=Stylosanthes hamata GN=ST3 PE=2 SV=1 61 704 1.0E-41
sp|Q9EPH0|S26A5_RAT Prestin OS=Rattus norvegicus GN=Slc26a5 PE=1 SV=1 63 533 4.0E-41
sp|O04289|SUT32_ARATH Sulfate transporter 3.2 OS=Arabidopsis thaliana GN=SULTR3;2 PE=2 SV=1 65 719 8.0E-41
sp|Q9FEP7|SUT13_ARATH Sulfate transporter 1.3 OS=Arabidopsis thaliana GN=SULTR1;3 PE=2 SV=1 65 657 1.0E-40
sp|Q9JKQ2|S26A5_MERUN Prestin OS=Meriones unguiculatus GN=SLC26A5 PE=1 SV=1 63 533 1.0E-40
sp|Q99NH7|S26A5_MOUSE Prestin OS=Mus musculus GN=Slc26a5 PE=2 SV=3 63 533 2.0E-40
sp|Q62273|S26A2_MOUSE Sulfate transporter OS=Mus musculus GN=Slc26a2 PE=1 SV=1 47 510 5.0E-40
sp|P58743|S26A5_HUMAN Prestin OS=Homo sapiens GN=SLC26A5 PE=2 SV=1 63 533 5.0E-40
sp|O70531|S26A2_RAT Sulfate transporter OS=Rattus norvegicus GN=Slc26a2 PE=2 SV=1 63 510 3.0E-39
sp|Q924C9|S26A3_RAT Chloride anion exchanger OS=Rattus norvegicus GN=Slc26a3 PE=2 SV=1 68 643 5.0E-39
sp|Q65AC2|S26A2_HORSE Sulfate transporter OS=Equus caballus GN=SLC26A2 PE=2 SV=1 52 517 3.0E-38
sp|P58735|S26A1_MOUSE Sulfate anion transporter 1 OS=Mus musculus GN=Slc26a1 PE=1 SV=1 65 511 4.0E-38
sp|P45380|S26A1_RAT Sulfate anion transporter 1 OS=Rattus norvegicus GN=Slc26a1 PE=1 SV=1 65 511 5.0E-38
sp|Q9BXS9|S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens GN=SLC26A6 PE=1 SV=1 38 511 6.0E-38
sp|Q9MAX3|SUT12_ARATH Sulfate transporter 1.2 OS=Arabidopsis thaliana GN=SULTR1;2 PE=1 SV=1 65 657 7.0E-38
sp|Q94LW6|SUT35_ARATH Probable sulfate transporter 3.5 OS=Arabidopsis thaliana GN=SULTR3;5 PE=2 SV=1 70 511 2.0E-37
sp|Q02920|NO70_SOYBN Early nodulin-70 OS=Glycine max PE=2 SV=1 55 490 2.0E-37
sp|O43511|S26A4_HUMAN Pendrin OS=Homo sapiens GN=SLC26A4 PE=1 SV=1 41 477 3.0E-36
sp|Q9R155|S26A4_MOUSE Pendrin OS=Mus musculus GN=Slc26a4 PE=1 SV=1 65 478 7.0E-36
sp|A6QNW6|S26A8_BOVIN Testis anion transporter 1 OS=Bos taurus GN=SLC26A8 PE=2 SV=1 68 511 7.0E-36
sp|Q8R2Z3|S26A7_MOUSE Anion exchange transporter OS=Mus musculus GN=Slc26a7 PE=2 SV=3 63 528 8.0E-36
sp|Q9GJY3|S26A2_SHEEP Sulfate transporter OS=Ovis aries GN=SLC26A2 PE=3 SV=1 55 510 1.0E-35
sp|P50443|S26A2_HUMAN Sulfate transporter OS=Homo sapiens GN=SLC26A2 PE=1 SV=2 43 517 2.0E-35
sp|Q9R154|S26A4_RAT Pendrin OS=Rattus norvegicus GN=Slc26a4 PE=2 SV=1 65 478 3.0E-35
sp|Q96RN1|S26A8_HUMAN Testis anion transporter 1 OS=Homo sapiens GN=SLC26A8 PE=1 SV=1 68 511 5.0E-35
sp|Q9BEG8|S26A2_BOVIN Sulfate transporter OS=Bos taurus GN=SLC26A2 PE=3 SV=1 57 510 6.0E-35
sp|Q69DJ1|S26A2_BUBBU Sulfate transporter OS=Bubalus bubalis GN=SLC26A2 PE=3 SV=1 57 510 6.0E-35
sp|Q9WVC8|S26A3_MOUSE Chloride anion exchanger OS=Mus musculus GN=Slc26a3 PE=1 SV=1 68 643 2.0E-33
sp|Q5EBI0|S2610_MOUSE Solute carrier family 26 member 10 OS=Mus musculus GN=Slc26a10 PE=2 SV=1 57 468 4.0E-33
sp|Q5RAL2|S26A7_PONAB Anion exchange transporter OS=Pongo abelii GN=SLC26A7 PE=2 SV=1 50 528 4.0E-33
sp|Q8TE54|S26A7_HUMAN Anion exchange transporter OS=Homo sapiens GN=SLC26A7 PE=2 SV=2 50 528 5.0E-33
sp|Q4R445|S26A8_MACFA Testis anion transporter 1 OS=Macaca fascicularis GN=SLC26A8 PE=2 SV=1 68 511 7.0E-33
sp|Q8R0C3|S26A8_MOUSE Testis anion transporter 1 OS=Mus musculus GN=Slc26a8 PE=2 SV=2 68 511 1.0E-31
sp|P9WGF6|Y1739_MYCTO Probable sulfate transporter MT1781 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1781 PE=3 SV=1 70 510 4.0E-31
sp|Q94225|SULP3_CAEEL Sulfate permease family protein 3 OS=Caenorhabditis elegans GN=sulp-3 PE=2 SV=3 68 511 5.0E-31
sp|P9WGF7|Y1739_MYCTU Probable sulfate transporter Rv1739c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1739c PE=1 SV=1 70 510 9.0E-31
sp|Q8BU91|S26A9_MOUSE Solute carrier family 26 member 9 OS=Mus musculus GN=Slc26a9 PE=2 SV=1 68 511 4.0E-30
sp|A4IIF2|S26A9_XENTR Solute carrier family 26 member 9 OS=Xenopus tropicalis GN=slc26a9 PE=2 SV=1 63 517 1.0E-28
sp|Q7LBE3|S26A9_HUMAN Solute carrier family 26 member 9 OS=Homo sapiens GN=SLC26A9 PE=1 SV=1 68 511 9.0E-28
sp|P53394|SULX_YEAST Putative sulfate transporter YPR003C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR003C PE=1 SV=1 69 679 4.0E-27
sp|Q86WA9|S2611_HUMAN Sodium-independent sulfate anion transporter OS=Homo sapiens GN=SLC26A11 PE=2 SV=2 65 224 5.0E-27
sp|Q80ZD3|S2611_MOUSE Sodium-independent sulfate anion transporter OS=Mus musculus GN=Slc26a11 PE=2 SV=2 57 224 8.0E-27
sp|Q8NG04|S2610_HUMAN Solute carrier family 26 member 10 OS=Homo sapiens GN=SLC26A10 PE=2 SV=1 102 469 1.0E-21
sp|P0AFR2|DAUA_ECOLI C4-dicarboxylic acid transporter DauA OS=Escherichia coli (strain K12) GN=dauA PE=1 SV=2 72 503 1.0E-20
sp|P0AFR3|DAUA_ECO57 C4-dicarboxylic acid transporter DauA OS=Escherichia coli O157:H7 GN=dauA PE=3 SV=2 72 503 1.0E-20
sp|O06984|YVDB_BACSU Putative sulfate transporter YvdB OS=Bacillus subtilis (strain 168) GN=yvdB PE=3 SV=1 76 409 2.0E-20
sp|P55189|YBAR_BACSU Putative sulfate transporter YbaR OS=Bacillus subtilis (strain 168) GN=ybaR PE=3 SV=2 86 443 3.0E-14
sp|O59782|SULH3_SCHPO Probable sulfate permease C320.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.05 PE=3 SV=1 53 505 4.0E-12
sp|Q14SY0|BICA_SYNP2 Bicarbonate transporter BicA OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=bicA PE=1 SV=1 76 441 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008272 sulfate transport Yes
GO:0015116 sulfate transmembrane transporter activity Yes
GO:0006820 anion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0015698 inorganic anion transport No
GO:0072348 sulfur compound transport No
GO:0006811 ion transport No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 124 146 22
3 167 189 22
4 199 221 22
5 242 264 22
6 279 301 22
7 333 355 22
8 375 397 22
9 410 432 22
10 459 478 19
11 485 502 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10356
MVGRRIADLVSTRLLGLDVSAFSPDLDTRAQDVLGPAQAYFEEEPTIWEWFAELKPTGAGAVDYIKELFPAASWM
RRYNLRWLLGDLVAGITVGLVVVPQALAYAALADLPPAFGLYTSFSGAAVYWLFGTSRDVMIGTTAVGSLLVGQV
IGRVNERSSELVPAEDTARGLSLMTGVALLFFGLLRLGWIIEFIPYIPISAFVTGASITIICAQLPTLLGVRGIN
AREAPYRVFSNLCRRLYSIHLDIFIGLSSLFLLFAVRKFCSVMEVRQPGHKRLWATISSLRMTFTMLLFTGIAWL
VDRRLEFPTKFNIVGPIETGFKRAGAPNLDTNLIKAILPELPAVAVILVIEHIAIAKAMGRLYNYQVNPSQEIAA
LGVANLVSPFFGGYIATGSFGASAVLSKAGARSPLGGLFSAGVVALALYHLTGAFFFIPKAALSGLIVHAVSNLI
TPPAKLVKYWQLSPVEFVIWLTSVLFAIFKSLESSIYVGVALSFALLLFRIARPRGTMLGRARARRIGCDEGLEL
DDEGKDAPRDVFLSVDGKGATNGAVKVESPYPGIFIYRPGDGFNYINQAYHVDVITQYVMQKTKRMTEEDFAKES
DRLWNDAGPKAYRANTEALPHLRALVLDFAAVGNVDVTSVQGLIDLRNLLDRHASPGAVEWHFANVDSRWTRRAL
AAAGFGYPTATDPEAMGKWRPVYSIAAALLEKQEPARASPDLDGADEEKAAWDRTPTSTESSTYANDAYARAVGM
ATVGSVDRPFFHVDLRDAVDCAVRDAKFRDKHMS*
Coding >Hirsu2|10356
ATGGTCGGCCGACGAATCGCCGACCTTGTCTCGACACGGCTCCTGGGACTCGACGTCTCCGCCTTCTCTCCCGAC
CTCGACACCCGGGCTCAAGATGTGCTTGGTCCTGCCCAAGCCTACTTCGAGGAGGAGCCGACCATCTGGGAGTGG
TTCGCGGAGCTGAAGCCGACCGGCGCCGGCGCCGTCGACTACATCAAGGAGCTGTTTCCCGCTGCGTCGTGGATG
AGGCGCTATAATCTGCGCTGGCTGCTGGGGGATCTGGTCGCCGGCATTACTGTTGGCCTGGTTGTCGTTCCCCAG
GCGCTCGCATATGCTGCGCTCGCCGACCTGCCGCCGGCCTTTGGCCTATACACCTCCTTTTCCGGCGCGGCCGTC
TACTGGCTATTCGGCACTTCGAGAGACGTCATGATCGGGACAACGGCAGTGGGGTCGCTTCTGGTGGGCCAGGTT
ATTGGCCGAGTCAACGAGCGCTCGTCCGAATTGGTTCCGGCCGAGGATACGGCTCGCGGTCTCAGCCTCATGACA
GGCGTCGCCTTGCTCTTCTTCGGGCTGCTGCGGCTCGGGTGGATCATTGAATTCATTCCCTACATTCCCATCTCT
GCATTCGTCACGGGTGCCAGCATCACCATCATCTGTGCTCAGCTGCCCACCTTGTTGGGCGTCAGGGGGATCAAC
GCGCGGGAGGCGCCCTATCGCGTCTTCAGCAATCTCTGCCGGCGTCTCTACAGCATCCACCTGGACATCTTCATT
GGCCTGTCCTCCTTGTTCCTGCTCTTTGCCGTCCGGAAATTCTGCTCCGTGATGGAGGTGCGCCAGCCGGGCCAC
AAGCGCCTCTGGGCCACCATCTCGTCTCTCCGCATGACTTTCACCATGCTGCTCTTTACGGGTATCGCCTGGCTC
GTTGATCGCCGCCTTGAGTTCCCGACCAAGTTCAACATCGTCGGCCCAATCGAGACAGGCTTCAAACGGGCTGGC
GCGCCAAACCTGGATACGAATCTGATCAAGGCAATCCTGCCTGAACTACCTGCCGTGGCCGTCATTCTGGTCATT
GAGCATATTGCCATTGCGAAGGCCATGGGTAGGCTGTATAATTACCAGGTCAACCCGTCTCAGGAGATTGCGGCG
CTGGGCGTGGCCAACCTGGTCAGCCCCTTTTTCGGAGGCTACATCGCCACGGGCTCCTTCGGCGCCTCCGCCGTC
CTGTCCAAGGCGGGCGCCCGAAGCCCGCTGGGCGGCTTGTTCAGCGCCGGCGTCGTCGCCCTCGCGCTATACCAC
CTGACCGGCGCGTTCTTCTTCATACCCAAGGCCGCTCTGTCGGGGCTGATCGTCCACGCGGTGTCCAACCTGATC
ACGCCGCCGGCGAAGCTTGTCAAGTACTGGCAGCTGTCGCCGGTTGAGTTTGTGATTTGGCTCACCAGCGTCCTC
TTCGCCATCTTCAAGTCCCTCGAGTCGTCCATCTACGTCGGAGTTGCCCTGTCGTTTGCCCTGCTCCTCTTCCGC
ATTGCCAGGCCAAGGGGCACGATGCTCGGCCGGGCGCGAGCGCGGCGCATCGGCTGCGACGAGGGCCTCGAGCTC
GACGACGAGGGCAAAGACGCGCCCCGGGACGTGTTCCTGTCCGTGGACGGAAAGGGCGCGACAAACGGCGCCGTC
AAGGTCGAGTCGCCCTATCCGGGCATCTTCATCTACCGCCCGGGCGACGGGTTCAACTACATCAACCAGGCCTAC
CACGTCGACGTCATCACCCAGTACGTGATGCAGAAGACGAAACGGATGACGGAGGAAGACTTCGCGAAGGAGTCG
GACCGTCTGTGGAACGACGCGGGCCCGAAGGCGTACAGGGCCAATACGGAGGCCCTCCCTCACCTTCGGGCCCTC
GTCCTCGACTTTGCGGCGGTGGGCAACGTGGACGTGACGTCGGTGCAGGGTTTGATCGACCTGAGGAACTTGCTG
GACCGGCACGCGTCTCCGGGGGCGGTCGAGTGGCACTTTGCCAACGTCGACAGCCGCTGGACCCGCCGGGCACTG
GCGGCAGCCGGCTTCGGGTATCCGACGGCGACGGATCCCGAGGCGATGGGCAAGTGGAGGCCGGTGTACAGCATT
GCCGCGGCGCTGCTGGAGAAGCAAGAGCCGGCCAGGGCCTCGCCGGACCTGGACGGCGCGGACGAGGAGAAGGCG
GCGTGGGACAGGACGCCGACGTCGACGGAGTCGTCAACGTACGCCAACGACGCCTACGCTCGGGCCGTTGGGATG
GCGACGGTCGGCAGCGTCGACCGACCCTTCTTCCACGTCGACCTGCGGGACGCGGTGGACTGCGCGGTGCGAGAC
GCGAAGTTCAGGGACAAGCACATGTCGTGA
Transcript >Hirsu2|10356
ATGGTCGGCCGACGAATCGCCGACCTTGTCTCGACACGGCTCCTGGGACTCGACGTCTCCGCCTTCTCTCCCGAC
CTCGACACCCGGGCTCAAGATGTGCTTGGTCCTGCCCAAGCCTACTTCGAGGAGGAGCCGACCATCTGGGAGTGG
TTCGCGGAGCTGAAGCCGACCGGCGCCGGCGCCGTCGACTACATCAAGGAGCTGTTTCCCGCTGCGTCGTGGATG
AGGCGCTATAATCTGCGCTGGCTGCTGGGGGATCTGGTCGCCGGCATTACTGTTGGCCTGGTTGTCGTTCCCCAG
GCGCTCGCATATGCTGCGCTCGCCGACCTGCCGCCGGCCTTTGGCCTATACACCTCCTTTTCCGGCGCGGCCGTC
TACTGGCTATTCGGCACTTCGAGAGACGTCATGATCGGGACAACGGCAGTGGGGTCGCTTCTGGTGGGCCAGGTT
ATTGGCCGAGTCAACGAGCGCTCGTCCGAATTGGTTCCGGCCGAGGATACGGCTCGCGGTCTCAGCCTCATGACA
GGCGTCGCCTTGCTCTTCTTCGGGCTGCTGCGGCTCGGGTGGATCATTGAATTCATTCCCTACATTCCCATCTCT
GCATTCGTCACGGGTGCCAGCATCACCATCATCTGTGCTCAGCTGCCCACCTTGTTGGGCGTCAGGGGGATCAAC
GCGCGGGAGGCGCCCTATCGCGTCTTCAGCAATCTCTGCCGGCGTCTCTACAGCATCCACCTGGACATCTTCATT
GGCCTGTCCTCCTTGTTCCTGCTCTTTGCCGTCCGGAAATTCTGCTCCGTGATGGAGGTGCGCCAGCCGGGCCAC
AAGCGCCTCTGGGCCACCATCTCGTCTCTCCGCATGACTTTCACCATGCTGCTCTTTACGGGTATCGCCTGGCTC
GTTGATCGCCGCCTTGAGTTCCCGACCAAGTTCAACATCGTCGGCCCAATCGAGACAGGCTTCAAACGGGCTGGC
GCGCCAAACCTGGATACGAATCTGATCAAGGCAATCCTGCCTGAACTACCTGCCGTGGCCGTCATTCTGGTCATT
GAGCATATTGCCATTGCGAAGGCCATGGGTAGGCTGTATAATTACCAGGTCAACCCGTCTCAGGAGATTGCGGCG
CTGGGCGTGGCCAACCTGGTCAGCCCCTTTTTCGGAGGCTACATCGCCACGGGCTCCTTCGGCGCCTCCGCCGTC
CTGTCCAAGGCGGGCGCCCGAAGCCCGCTGGGCGGCTTGTTCAGCGCCGGCGTCGTCGCCCTCGCGCTATACCAC
CTGACCGGCGCGTTCTTCTTCATACCCAAGGCCGCTCTGTCGGGGCTGATCGTCCACGCGGTGTCCAACCTGATC
ACGCCGCCGGCGAAGCTTGTCAAGTACTGGCAGCTGTCGCCGGTTGAGTTTGTGATTTGGCTCACCAGCGTCCTC
TTCGCCATCTTCAAGTCCCTCGAGTCGTCCATCTACGTCGGAGTTGCCCTGTCGTTTGCCCTGCTCCTCTTCCGC
ATTGCCAGGCCAAGGGGCACGATGCTCGGCCGGGCGCGAGCGCGGCGCATCGGCTGCGACGAGGGCCTCGAGCTC
GACGACGAGGGCAAAGACGCGCCCCGGGACGTGTTCCTGTCCGTGGACGGAAAGGGCGCGACAAACGGCGCCGTC
AAGGTCGAGTCGCCCTATCCGGGCATCTTCATCTACCGCCCGGGCGACGGGTTCAACTACATCAACCAGGCCTAC
CACGTCGACGTCATCACCCAGTACGTGATGCAGAAGACGAAACGGATGACGGAGGAAGACTTCGCGAAGGAGTCG
GACCGTCTGTGGAACGACGCGGGCCCGAAGGCGTACAGGGCCAATACGGAGGCCCTCCCTCACCTTCGGGCCCTC
GTCCTCGACTTTGCGGCGGTGGGCAACGTGGACGTGACGTCGGTGCAGGGTTTGATCGACCTGAGGAACTTGCTG
GACCGGCACGCGTCTCCGGGGGCGGTCGAGTGGCACTTTGCCAACGTCGACAGCCGCTGGACCCGCCGGGCACTG
GCGGCAGCCGGCTTCGGGTATCCGACGGCGACGGATCCCGAGGCGATGGGCAAGTGGAGGCCGGTGTACAGCATT
GCCGCGGCGCTGCTGGAGAAGCAAGAGCCGGCCAGGGCCTCGCCGGACCTGGACGGCGCGGACGAGGAGAAGGCG
GCGTGGGACAGGACGCCGACGTCGACGGAGTCGTCAACGTACGCCAACGACGCCTACGCTCGGGCCGTTGGGATG
GCGACGGTCGGCAGCGTCGACCGACCCTTCTTCCACGTCGACCTGCGGGACGCGGTGGACTGCGCGGTGCGAGAC
GCGAAGTTCAGGGACAAGCACATGTCGTGA
Gene >Hirsu2|10356
ATGGTCGGCCGACGAATCGCCGACCTTGTCTCGACACGGCTCCTGGGACTCGACGTCTCCGCCTTCTCTCCCGAC
CTCGACACCCGGGCTCAAGATGTGCTTGGTCCTGCCCAAGCCTACTTCGAGGAGGAGCCGACCATCTGGGAGTGG
TTCGCGGAGCTGAAGCCGACCGGCGCCGGCGCCGTCGACTACATCAAGGAGCTGTTTCCCGCTGCGTCGTGGATG
AGGCGCTATAATCTGCGCTGGCTGCTGGGGGATCTGGTCGCCGGTTCGTCTCGCCCTCCGCCCTGCTTTTCGTTG
TCCGCAGCCTCCCTGACTGCTTTTCGCAGGCATTACTGTTGGCCTGGTTGTCGTTCCCCAGGCGCTCGCATATGC
TGCGCTCGCCGACCTGCCGCCGGCCTTTGGCCTATACACCTCCTTTTCCGGCGCGGCCGTCTACTGGCTATTCGG
CACTTCGAGAGACGTCATGATCGGGGTCCGTTTCCACCGCCCCCTTCGCCTCCCGCCCCGTGCCGGCTAACAGAG
GACGGGCAGACAACGGCAGTGGGGTCGCTTCTGGTGGGCCAGGTTATTGGCCGAGTCAACGAGCGCTCGTCCGAA
TTGGTTCCGGCCGAGGATACGGCTCGCGGTCTCAGCCTCATGACAGGCGTCGCCTTGCTCTTCTTCGGGCTGCTG
CGGCTCGGGTGGATCATTGAATTCATTCCCTACATTCCCATCTCTGCATTCGTCACGGGTGCCAGCATCACCATC
ATCTGTGCTCAGCTGCCCACCTTGTTGGGCGTCAGGGGGATCAACGCGCGGGAGGCGCCCTATCGCGTCTTCAGC
AATCTCTGCCGGCGTCTCTACAGCATCCACCTGGACATCTTCATTGGCCTGTCCTCCTTGTTCCTGCTCTTTGCC
GTCCGGAAATTCTGCTCCGTGATGGAGGTGCGCCAGCCGGGCCACAAGCGCCTCTGGGCCACCATCTCGTCTCTC
CGCATGACTTTCACCATGCTGCTCTTTACGGGTATCGCCTGGCTCGTTGATCGCCGCCTTGAGTTCCCGACCAAG
TTCAACATCGTCGGCCCAATCGAGACAGGTATGCAAGTCCCCCATCTCCACATGGGCCCATGGCCTCACCATCAG
CATCCCGACGCGCCTTGGTCTGACCAGTGACTCGGCAGGCTTCAAACGGGCTGGCGCGCCAAACCTGGATACGAA
TCTGATCAAGGCAATCCTGCCTGAACTACCTGCCGTGGCCGTCATTCTGGTCATTGAGCATATTGCCATTGCGAA
GGCCATGGGTAGGCTGTATAATTACCAGGTCAACCCGTCTCAGGAGATTGCGGCGCTGGGCGTGGCCAACCTGGT
CAGCCCCTTTTTCGGAGGCTACATCGCCACGGGCTCCTTCGGCGCCTCCGCCGTCCTGTCCAAGGCGGGCGCCCG
AAGCCCGCTGGGCGGCTTGTTCAGCGCCGGCGTCGTCGCCCTCGCGCTATACCACCTGACCGGCGCGTTCTTCTT
CATACCCAAGGCCGCTCTGTCGGGGCTGATCGTCCACGCGGTGTCCAACCTGATCACGCCGCCGGCGAAGCTTGT
CAAGTACTGGCAGCTGTCGCCGGTTGAGTTTGTGATTTGGCTCACCAGCGTCCTCTTCGCCATCTTCAAGTCCCT
CGAGTCGTCCATCTACGTCGGAGTTGCCCTGTCGTTTGCCCTGCTCCTCTTCCGCATTGCCAGGCCAAGGGGCAC
GATGCTCGGCCGGGCGCGAGCGCGGCGCATCGGCTGCGACGAGGGCCTCGAGCTCGACGACGAGGGCAAAGACGC
GCCCCGGGACGTGTTCCTGTCCGTGGACGGAAAGGGCGCGACAAACGGCGCCGTCAAGGTCGAGTCGCCCTATCC
GGGCATCTTCATCTACCGCCCGGGCGACGGGTTCAACTACATCAACCAGGCCTACCACGTCGACGTCATCACCCA
GTACGTGATGCAGAAGACGAAACGGATGACGGAGGAAGACTTCGCGAAGGAGTCGGACCGTCTGTGGAACGACGC
GGGCCCGAAGGCGTACAGGGCCAATACGGAGGCCCTCCCTCACCTTCGGGCCCTCGTCCTCGACTTTGCGGCGGT
GGGCAACGTGGACGTGACGTCGGTGCAGGGTTTGATCGACCTGAGGAACTTGCTGGACCGGCACGCGTCTCCGGG
GGCGGTCGAGTGGCACTTTGCCAACGTCGACAGCCGCTGGACCCGCCGGGCACTGGCGGCAGCCGGCTTCGGGTA
TCCGACGGCGACGGATCCCGAGGCGATGGGCAAGTGGAGGCCGGTGTACAGCATTGCCGCGGCGCTGCTGGAGAA
GCAAGAGCCGGCCAGGGCCTCGCCGGACCTGGACGGCGCGGACGAGGAGAAGGCGGCGTGGGACAGGACGCCGAC
GTCGACGGAGTCGTCAACGTACGCCAACGACGCCTACGCTCGGGCCGTTGGGATGGCGACGGTCGGCAGCGTCGA
CCGACCCTTCTTCCACGTCGACCTGCGGGACGCGGTGGACTGCGCGGTGCGAGACGCGAAGTTCAGGGACAAGCA
CATGTCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail