Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10352
Gene name
LocationContig_83:27..1606
Strand+
Gene length (bp)1579
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 5.9E-24 93 278
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 1.6E-08 297 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 37 374 3.0E-64
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 26 383 4.0E-64
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 46 374 3.0E-63
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 44 374 4.0E-62
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 64 374 2.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 37 374 3.0E-64
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 26 383 4.0E-64
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 46 374 3.0E-63
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 44 374 4.0E-62
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 64 374 2.0E-60
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 45 367 1.0E-56
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 29 367 1.0E-56
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 46 367 3.0E-55
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 53 368 2.0E-39
sp|Q57891|Y449_METJA Uncharacterized transporter MJ0449 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0449 PE=3 SV=1 113 362 9.0E-15
sp|P21559|P34_RICRS Protein p34 OS=Rickettsia rickettsii (strain Sheila Smith) GN=p34 PE=3 SV=1 86 344 5.0E-08
sp|Q6CZ45|FIEF_PECAS Cation-efflux pump FieF OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fieF PE=3 SV=1 86 362 2.0E-07
sp|B1JQU5|FIEF_YERPY Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fieF PE=3 SV=1 99 348 3.0E-07
sp|Q66GA9|FIEF_YERPS Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fieF PE=3 SV=1 99 348 3.0E-07
sp|A4TSA8|FIEF_YERPP Cation-efflux pump FieF OS=Yersinia pestis (strain Pestoides F) GN=fieF PE=3 SV=1 99 348 3.0E-07
sp|Q1CD32|FIEF_YERPN Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fieF PE=3 SV=1 99 348 3.0E-07
sp|A9R6A2|FIEF_YERPG Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fieF PE=3 SV=1 99 348 3.0E-07
sp|Q8ZJL7|FIEF_YERPE Cation-efflux pump FieF OS=Yersinia pestis GN=fieF PE=3 SV=1 99 348 3.0E-07
sp|B2JZA2|FIEF_YERPB Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fieF PE=3 SV=1 99 348 3.0E-07
sp|Q1C296|FIEF_YERPA Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fieF PE=3 SV=1 99 348 3.0E-07
sp|C0SP78|YDFM_BACSU Uncharacterized transporter YdfM OS=Bacillus subtilis (strain 168) GN=ydfM PE=3 SV=1 97 362 7.0E-07
sp|P46348|YEAB_BACSU Uncharacterized transporter YeaB OS=Bacillus subtilis (strain 168) GN=yeaB PE=3 SV=2 93 362 3.0E-06
sp|A1JHZ2|FIEF_YERE8 Cation-efflux pump FieF OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fieF PE=3 SV=1 86 348 5.0E-06
sp|C6DHK1|FIEF_PECCP Cation-efflux pump FieF OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fieF PE=3 SV=1 86 348 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 88 110 22
2 114 136 22
3 157 179 22
4 194 216 22
5 250 272 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10352
LPAVDGAAAEALENVPLNGGDGDAAEVPNPIDPDLLRQAKYDDFKGDRKKLRKFYTQQNELIDQFLGADDEERLA
SDEEVRVRPKIRFAVYGSFAVNFCLFVIQLYAAVSTGSLSLFATAADAFMDLVSSCVMVITSKLARRPNVYRFPV
GRTRIEPVGIIIFCALMATVAVELLIESARTLAGGQKAASPLQPVPLALVGVAILSKSSMMVFCFFYRRFPSVRV
FFVDHRNDIVVNVFGLVMSIAGDHFIWYLDPVGAICIALLILFSWAANAFDQVWLLAGKSAPRAYISKLIYVTLT
HSKHILEVDTCRAYHAGQKFYVEVDVVMDADTPLRVSHDVSQSLQRKLEGLADVERAFVHVDYDHDHNIHEEHKP
LYEYTKSRRLRDYIRLTKRAIFR*
Coding >Hirsu2|10352
CTGCCGGCCGTGGACGGCGCCGCGGCCGAGGCGCTGGAGAACGTGCCGCTCAACGGCGGCGACGGCGACGCGGCC
GAGGTGCCCAACCCCATCGACCCGGACCTGCTGCGGCAGGCCAAGTACGACGACTTCAAGGGCGACCGCAAGAAG
CTGCGCAAGTTCTACACGCAGCAGAACGAGCTGATCGACCAGTTCCTCGGCGCCGACGACGAGGAGCGCCTGGCG
TCGGACGAGGAGGTGCGCGTGCGGCCCAAGATCCGCTTCGCCGTCTACGGCTCCTTCGCCGTCAACTTCTGCCTC
TTCGTCATCCAGCTCTATGCCGCCGTCTCGACCGGCTCGCTCTCGCTCTTCGCGACGGCAGCCGATGCCTTCATG
GACCTCGTCTCCTCGTGCGTCATGGTCATCACCTCCAAGCTCGCCAGGCGGCCCAACGTCTATCGCTTCCCCGTC
GGCCGGACGAGGATCGAGCCGGTCGGCATCATCATCTTCTGCGCGCTCATGGCCACCGTCGCCGTCGAGCTGCTC
ATCGAGTCGGCCCGCACTCTTGCCGGGGGCCAGAAGGCGGCATCGCCGTTGCAGCCCGTGCCGCTGGCCCTGGTC
GGCGTTGCCATCTTGTCCAAGAGCTCGATGATGGTCTTCTGCTTCTTCTACCGCCGCTTCCCCTCCGTGCGCGTC
TTCTTCGTCGACCACCGCAACGACATCGTCGTCAACGTCTTCGGCCTCGTCATGTCCATCGCGGGCGACCACTTC
ATCTGGTACCTCGACCCGGTCGGCGCCATCTGCATCGCCCTCCTCATCCTCTTCTCCTGGGCCGCCAACGCCTTC
GACCAGGTCTGGCTGCTGGCCGGCAAGAGCGCGCCCAGGGCGTACATCTCCAAGCTCATCTACGTCACCCTGACG
CACAGCAAGCACATCCTCGAGGTCGACACCTGCCGCGCCTACCACGCCGGCCAGAAGTTCTACGTCGAGGTGGAC
GTCGTCATGGACGCCGACACTCCGCTGCGCGTCTCCCACGACGTGAGCCAGTCTCTGCAGCGCAAGCTCGAGGGC
CTGGCCGATGTCGAGAGGGCCTTCGTCCACGTCGACTACGACCACGACCACAACATCCACGAGGAGCACAAGCCG
CTCTACGAGTACACCAAGTCGAGGAGGTTGAGGGACTACATCCGTCTCACCAAACGGGCCATCTTCCGCTAG
Transcript >Hirsu2|10352
CTGCCGGCCGTGGACGGCGCCGCGGCCGAGGCGCTGGAGAACGTGCCGCTCAACGGCGGCGACGGCGACGCGGCC
GAGGTGCCCAACCCCATCGACCCGGACCTGCTGCGGCAGGCCAAGTACGACGACTTCAAGGGCGACCGCAAGAAG
CTGCGCAAGTTCTACACGCAGCAGAACGAGCTGATCGACCAGTTCCTCGGCGCCGACGACGAGGAGCGCCTGGCG
TCGGACGAGGAGGTGCGCGTGCGGCCCAAGATCCGCTTCGCCGTCTACGGCTCCTTCGCCGTCAACTTCTGCCTC
TTCGTCATCCAGCTCTATGCCGCCGTCTCGACCGGCTCGCTCTCGCTCTTCGCGACGGCAGCCGATGCCTTCATG
GACCTCGTCTCCTCGTGCGTCATGGTCATCACCTCCAAGCTCGCCAGGCGGCCCAACGTCTATCGCTTCCCCGTC
GGCCGGACGAGGATCGAGCCGGTCGGCATCATCATCTTCTGCGCGCTCATGGCCACCGTCGCCGTCGAGCTGCTC
ATCGAGTCGGCCCGCACTCTTGCCGGGGGCCAGAAGGCGGCATCGCCGTTGCAGCCCGTGCCGCTGGCCCTGGTC
GGCGTTGCCATCTTGTCCAAGAGCTCGATGATGGTCTTCTGCTTCTTCTACCGCCGCTTCCCCTCCGTGCGCGTC
TTCTTCGTCGACCACCGCAACGACATCGTCGTCAACGTCTTCGGCCTCGTCATGTCCATCGCGGGCGACCACTTC
ATCTGGTACCTCGACCCGGTCGGCGCCATCTGCATCGCCCTCCTCATCCTCTTCTCCTGGGCCGCCAACGCCTTC
GACCAGGTCTGGCTGCTGGCCGGCAAGAGCGCGCCCAGGGCGTACATCTCCAAGCTCATCTACGTCACCCTGACG
CACAGCAAGCACATCCTCGAGGTCGACACCTGCCGCGCCTACCACGCCGGCCAGAAGTTCTACGTCGAGGTGGAC
GTCGTCATGGACGCCGACACTCCGCTGCGCGTCTCCCACGACGTGAGCCAGTCTCTGCAGCGCAAGCTCGAGGGC
CTGGCCGATGTCGAGAGGGCCTTCGTCCACGTCGACTACGACCACGACCACAACATCCACGAGGAGCACAAGCCG
CTCTACGAGTACACCAAGTCGAGGAGGTTGAGGGACTACATCCGTCTCACCAAACGGGCCATCTTCCGCTAG
Gene >Hirsu2|10352
CTGCCGGCCGTGGACGGCGCCGCGGCCGAGGCGCTGGAGAACGTGCCGCTCAACGGCGGCGACGGCGACGCGGCC
GAGGTGCCCAACCCCATCGACCCGGACCTGCTGCGGCAGGCCAAGTACGACGACTTCAAGGGCGACCGCAAGAAG
CTGCGCAAGTTCTACACGCAGCAGAACGAGCTGATCGACCAGTTCCTCGGCGCCGACGACGAGGAGCGCCTGGCG
TCGGACGAGGAGGTGCGCGTGCGGCCCAAGATCCGCTTCGCCGTCTACGGCTCCTTCGCCGTCAACTTCTGCCTC
TTCGTCATCCAGCTCTATGCCGCCGTCTCGACCGGCTCGCTCTCGGTATGCTCAGCCCTTTTCTGCTCTTCTCCC
GCTAAGCACCGGACTCGGCCCGCTGGTTGCGTATACATGTAGCTCTTCGCGACGGCAGCCGATGCCTTCATGGAC
CTCGTCTCCTCGTGCGTCATGGTCATCACCTCCAAGCTCGCCAGGCGGCCCAACGTCTATCGCTTCCCCGTCGTG
AGTCACTCGACCGGCTCCGCGTAGGGCGCGCGGGCGCGAGAGGCTGACGGAGGGAAAATCAAAAAACTCGCCACC
CGTTTTCTCAGGGCCGGACGAGGATCGAGCCGGTCGGCATCATCATCTTCTGCGCGCTCATGGCCACCGTCGCCG
TCGAGCTGCTCGTATGCGCCCCCTCCCGTCCCCCTTAACTCCTCTGCCGCTCGAGAGATCCGGTTCGTGTCTGCT
GACCGGGGGGGGAGCAGATCGAGTCGGCCCGCACTCTTGCCGGGGGCCAGAAGGCGGCATCGCCGTTGCAGCCCG
TGCCGCTGGCCCTGGTCGGCGTTGCCAGTATGGAGCTCGTCGCCCGGACGCGGTCGGTGCTGGTGCGGGTGTGCT
GACGGCCGGCGCAGTCTTGTCCAAGAGCTCGATGATGGTCTTCTGCTTCTTCTACCGCCGCTTCCCCTCCGTGCG
CGTCTTCTTCGTCGACCACCGCAACGACATCGTCGTCAACGTCTTCGGCCTCGTCATGTCCATCGCGGGCGACCA
CTTCATCTGGTACCTCGACCCGGTCGGCGCCATCTGCATCGCCCTCCTCATCCTCTTCTCCTGGGCCGCCAACGC
CTTCGACCAGGTCTGGCTGCTGGCCGGCAAGAGCGCGCCCAGGGCGTACATCTCCAAGCTCATCTACGTCACCCT
GACGCACAGCAAGCACATCCTCGAGGTCGACACCGTGAGCTTCTCCCCCACCCCCCCCCCCCCNNNNNNNNNNNN
NNNNNNNNNNCGCCGTCTGACCGTCGTGCGCCGCCAGTGCCGCGCCTACCACGCCGGCCAGAAGTTCTACGTCGA
GGTGGACGTCGTCATGGACGCCGACACTCCGCTGCGCGTCTCCCACGACGTGAGCCAGTCTCTGCAGCGCAAGCT
CGAGGGCCTGGCCGATGTCGAGAGGGCCTTCGTCCACGTCGACTACGACCACGACCACAACATCCACGAGGAGCA
CAAGCCGCTCTACGAGTACACCAAGTCGAGGAGGTTGAGGGACTACATCCGTCTCACCAAACGGGCCATCTTCCG
CTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail