Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1035
Gene name
LocationContig_1213:3840..4398
Strand+
Gene length (bp)558
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09447 Cnl2_NKP2 Cnl2/NKP2 family protein 4.5E-24 5 68

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0000776 kinetochore Yes
GO:0044446 intracellular organelle part No
GO:0043229 intracellular organelle No
GO:0044464 cell part No
GO:0043226 organelle No
GO:0032991 protein-containing complex No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0044424 intracellular part No
GO:0044422 organelle part No
GO:0005575 cellular_component No
GO:0044427 chromosomal part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1035
MAPSESDMLTKYLLQPAPLTAITSWEQFQALFPRPLRASPRLRSLFRDLQAQRNAVVDAVAANIAAETRRGAAMR
REVLARRREAERDEADGEIEMERALFGAASSAAQARHTLPSIVPELDGAAGVLEADVRRLRDEEAALLAALGHTV
GGLSDLRYGKLANGKLREQVLDGLESLEHACRDEP*
Coding >Hirsu2|1035
ATGGCCCCCTCCGAGTCCGACATGCTCACCAAGTACCTGCTCCAGCCGGCGCCGCTGACGGCCATCACCAGCTGG
GAGCAGTTCCAGGCGCTGTTCCCGCGACCGCTGCGCGCCTCGCCCCGCCTGCGCTCGCTCTTCCGCGATCTGCAG
GCCCAGCGCAACGCCGTCGTCGACGCGGTGGCGGCCAACATCGCGGCCGAGACGAGGCGCGGCGCCGCCATGCGC
AGGGAGGTCCTGGCCCGCCGCCGCGAGGCCGAGCGGGACGAGGCCGACGGCGAGATCGAGATGGAGCGCGCCCTC
TTCGGCGCCGCCAGCTCCGCCGCCCAGGCCCGGCACACGCTGCCCTCCATCGTGCCCGAGCTCGACGGCGCCGCT
GGCGTGCTTGAGGCCGACGTCCGCCGCCTGCGCGACGAGGAGGCCGCGCTGCTCGCCGCCCTCGGCCACACCGTC
GGCGGCCTGAGCGATCTCCGCTACGGGAAGCTGGCCAACGGCAAGCTGAGGGAACAGGTCCTCGACGGCCTTGAA
TCGCTGGAACATGCGTGCCGCGACGAGCCCTAG
Transcript >Hirsu2|1035
ATGGCCCCCTCCGAGTCCGACATGCTCACCAAGTACCTGCTCCAGCCGGCGCCGCTGACGGCCATCACCAGCTGG
GAGCAGTTCCAGGCGCTGTTCCCGCGACCGCTGCGCGCCTCGCCCCGCCTGCGCTCGCTCTTCCGCGATCTGCAG
GCCCAGCGCAACGCCGTCGTCGACGCGGTGGCGGCCAACATCGCGGCCGAGACGAGGCGCGGCGCCGCCATGCGC
AGGGAGGTCCTGGCCCGCCGCCGCGAGGCCGAGCGGGACGAGGCCGACGGCGAGATCGAGATGGAGCGCGCCCTC
TTCGGCGCCGCCAGCTCCGCCGCCCAGGCCCGGCACACGCTGCCCTCCATCGTGCCCGAGCTCGACGGCGCCGCT
GGCGTGCTTGAGGCCGACGTCCGCCGCCTGCGCGACGAGGAGGCCGCGCTGCTCGCCGCCCTCGGCCACACCGTC
GGCGGCCTGAGCGATCTCCGCTACGGGAAGCTGGCCAACGGCAAGCTGAGGGAACAGGTCCTCGACGGCCTTGAA
TCGCTGGAACATGCGTGCCGCGACGAGCCCTAG
Gene >Hirsu2|1035
ATGGCCCCCTCCGAGTCCGACATGCTCACCAAGTACCTGCTCCAGCCGGCGCCGCTGACGGCCATCACCAGCTGG
GAGCAGTTCCAGGCGCTGTTCCCGCGACCGCTGCGCGCCTCGCCCCGCCTGCGCTCGCTCTTCCGCGATCTGCAG
GCCCAGCGCAACGCCGTCGTCGACGCGGTGGCGGCCAACATCGCGGCCGAGACGAGGCGCGGCGCCGCCATGCGC
AGGGAGGTCCTGGCCCGCCGCCGCGAGGCCGAGCGGGACGAGGCCGACGGCGAGATCGAGATGGAGCGCGCCCTC
TTCGGCGCCGCCAGCTCCGCCGCCCAGGCCCGGCACACGCTGCCCTCCATCGTGCCCGAGCTCGACGGCGCCGCT
GGCGTGCTTGAGGCCGACGTCCGCCGCCTGCGCGACGAGGAGGCCGCGCTGCTCGCCGCCCTCGGCCACACCGTC
GGCGGCCTGAGCGATCTCCGCTACGGGAAGCTGGCCAACGGCAAGCTGAGGGAACAGGTCCTCGACGGCCTTGAA
TCGCTGGAACATGCGTGCCGCGACGAGCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail