Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10323
Gene name
LocationContig_822:943..3826
Strand-
Gene length (bp)2883
Transcript length (bp)2730
Coding sequence length (bp)2730
Protein length (aa) 910

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08236 SRI SRI (Set2 Rpb1 interacting) domain 1.6E-21 660 742
PF00856 SET SET domain 5.2E-18 187 293
PF17907 AWS AWS domain 2.4E-09 133 173
PF08711 Med26 TFIIS helical bundle-like domain 1.4E-05 439 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB50|SET2_GIBZE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET2 PE=3 SV=2 11 897 0.0E+00
sp|Q7RZU4|SET2_NEUCR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-2 PE=3 SV=1 1 886 0.0E+00
sp|Q2H988|SET2_CHAGB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET2 PE=3 SV=1 50 896 0.0E+00
sp|Q1DU03|SET2_COCIM Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Coccidioides immitis (strain RS) GN=SET2 PE=3 SV=2 66 781 0.0E+00
sp|Q4WTT2|SET2_ASPFU Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set2 PE=3 SV=1 66 819 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB50|SET2_GIBZE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET2 PE=3 SV=2 11 897 0.0E+00
sp|Q7RZU4|SET2_NEUCR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-2 PE=3 SV=1 1 886 0.0E+00
sp|Q2H988|SET2_CHAGB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET2 PE=3 SV=1 50 896 0.0E+00
sp|Q1DU03|SET2_COCIM Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Coccidioides immitis (strain RS) GN=SET2 PE=3 SV=2 66 781 0.0E+00
sp|Q4WTT2|SET2_ASPFU Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set2 PE=3 SV=1 66 819 0.0E+00
sp|Q2UTN6|SET2_ASPOR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set2 PE=3 SV=1 66 814 0.0E+00
sp|Q5ASA5|SET2_EMENI Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set2 PE=3 SV=1 66 774 0.0E+00
sp|O14026|SET2_SCHPO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set2 PE=1 SV=1 85 503 1.0E-145
sp|Q6C5G5|SET2_YARLI Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=set-2 PE=3 SV=1 80 742 6.0E-138
sp|Q6CXP5|SET2_KLULA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET2 PE=3 SV=1 83 738 9.0E-133
sp|Q6BM04|SET2_DEBHA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET2 PE=3 SV=2 85 607 1.0E-130
sp|Q6FX50|SET2_CANGA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET2 PE=3 SV=1 78 747 2.0E-128
sp|P46995|SET2_YEAST Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET2 PE=1 SV=2 82 735 3.0E-120
sp|Q757Y8|SET2_ASHGO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET2 PE=3 SV=2 87 740 2.0E-114
sp|Q59XV0|SET2_CANAL Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET2 PE=3 SV=1 85 595 2.0E-113
sp|P0CO28|SET2_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET2 PE=3 SV=1 84 495 7.0E-113
sp|P0CO29|SET2_CRYNB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET2 PE=3 SV=1 84 495 8.0E-113
sp|Q4PBL3|SET2_USTMA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET2 PE=3 SV=1 81 496 9.0E-100
sp|Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens GN=SETD2 PE=1 SV=3 102 463 4.0E-57
sp|E9Q5F9|SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus GN=Setd2 PE=1 SV=1 102 458 4.0E-57
sp|Q9VYD1|C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster GN=Set2 PE=1 SV=2 96 327 1.0E-50
sp|Q2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana GN=ASHH2 PE=1 SV=1 118 399 9.0E-46
sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 139 316 2.0E-44
sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 139 316 2.0E-43
sp|Q84WW6|ASHH1_ARATH Histone-lysine N-methyltransferase ASHH1 OS=Arabidopsis thaliana GN=ASHH1 PE=1 SV=1 113 320 2.0E-42
sp|O96028|NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens GN=WHSC1 PE=1 SV=1 110 321 1.0E-41
sp|Q8BVE8|NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus GN=Whsc1 PE=1 SV=2 139 321 1.0E-41
sp|Q6P2L6|NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 125 316 5.0E-41
sp|Q9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens GN=WHSC1L1 PE=1 SV=1 139 316 1.0E-40
sp|Q99MY8|ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus GN=Ash1l PE=1 SV=3 121 329 1.0E-38
sp|Q9NR48|ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens GN=ASH1L PE=1 SV=2 121 320 3.0E-37
sp|Q8MT36|MES4_DROME Probable histone-lysine N-methyltransferase Mes-4 OS=Drosophila melanogaster GN=Mes-4 PE=1 SV=2 139 320 8.0E-37
sp|Q949T8|ASHR3_ARATH Histone-lysine N-methyltransferase ASHR3 OS=Arabidopsis thaliana GN=ASHR3 PE=1 SV=1 128 353 1.0E-36
sp|Q9VW15|ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster GN=ash1 PE=1 SV=3 125 407 8.0E-35
sp|Q9M1X9|ASHH4_ARATH Putative histone-lysine N-methyltransferase ASHH4 OS=Arabidopsis thaliana GN=ASHH4 PE=3 SV=1 167 331 5.0E-31
sp|Q945S8|ASHH3_ARATH Histone-lysine N-methyltransferase ASHH3 OS=Arabidopsis thaliana GN=ASHH3 PE=2 SV=2 167 311 9.0E-29
sp|Q8IE95|SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) GN=SETVS PE=2 SV=1 102 332 5.0E-26
sp|Q75D88|SET1_ASHGO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET1 PE=3 SV=2 110 315 8.0E-24
sp|Q9Y7R4|SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set1 PE=1 SV=1 188 316 1.0E-22
sp|P38827|SET1_YEAST Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET1 PE=1 SV=1 167 316 1.0E-22
sp|Q6FKB1|SET1_CANGA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET1 PE=3 SV=1 155 316 5.0E-22
sp|Q2UMH3|SET1_ASPOR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set1 PE=3 SV=1 167 315 8.0E-22
sp|Q5B0Y5|SET1_EMENI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set1 PE=3 SV=1 149 315 2.0E-21
sp|Q4WNH8|SET1_ASPFU Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set1 PE=3 SV=1 167 315 2.0E-21
sp|Q1DR06|SET1_COCIM Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Coccidioides immitis (strain RS) GN=SET1 PE=3 SV=1 167 315 3.0E-21
sp|Q6CEK8|SET1_YARLI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SET1 PE=3 SV=1 172 315 6.0E-21
sp|F4K1J4|ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana GN=ATXR7 PE=2 SV=1 188 314 7.0E-21
sp|Q4PB36|SET1_USTMA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET1 PE=3 SV=1 188 315 2.0E-20
sp|Q8X0S9|SET1_NEUCR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-1 PE=3 SV=1 167 315 2.0E-20
sp|Q4I5R3|SET1_GIBZE Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET1 PE=3 SV=2 167 316 4.0E-20
sp|Q8IRW8|TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster GN=trr PE=1 SV=2 172 311 4.0E-20
sp|Q18221|SET2_CAEEL Probable histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans GN=set-2 PE=2 SV=2 163 316 1.0E-19
sp|Q2GWF3|SET1_CHAGB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET1 PE=3 SV=1 167 315 2.0E-19
sp|Q54HS3|SET1_DICDI Histone-lysine N-methyltransferase set1 OS=Dictyostelium discoideum GN=set1 PE=1 SV=1 157 311 2.0E-19
sp|Q6CIT4|SET1_KLULA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET1 PE=3 SV=1 167 316 3.0E-19
sp|Q5ABG1|SET1_CANAL Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET1 PE=3 SV=1 178 316 4.0E-19
sp|Q6BKL7|SET1_DEBHA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET1 PE=3 SV=2 178 316 6.0E-19
sp|Q28CQ7|SUV92_XENTR Histone-lysine N-methyltransferase SUV39H2 OS=Xenopus tropicalis GN=suv39h2 PE=2 SV=2 153 315 7.0E-19
sp|Q24742|TRX_DROVI Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis GN=trx PE=3 SV=1 178 315 8.0E-19
sp|P55200|KMT2A_MOUSE Histone-lysine N-methyltransferase 2A OS=Mus musculus GN=Kmt2a PE=1 SV=3 178 315 2.0E-18
sp|Q03164|KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens GN=KMT2A PE=1 SV=5 178 315 2.0E-18
sp|P20659|TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster GN=trx PE=1 SV=4 178 315 3.0E-18
sp|Q98SM3|EZH2A_XENLA Histone-lysine N-methyltransferase EZH2 OS=Xenopus laevis GN=ezh2-a PE=2 SV=1 164 292 3.0E-18
sp|A8XI75|SET23_CAEBR Probable histone-lysine N-methyltransferase set-23 OS=Caenorhabditis briggsae GN=set-23 PE=3 SV=1 125 315 8.0E-18
sp|Q4R381|EZH2_MACFA Histone-lysine N-methyltransferase EZH2 OS=Macaca fascicularis GN=EZH2 PE=2 SV=1 164 292 9.0E-18
sp|Q15910|EZH2_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens GN=EZH2 PE=1 SV=2 164 292 9.0E-18
sp|Q61188|EZH2_MOUSE Histone-lysine N-methyltransferase EZH2 OS=Mus musculus GN=Ezh2 PE=1 SV=2 164 292 1.0E-17
sp|Q28D84|EZH2_XENTR Histone-lysine N-methyltransferase EZH2 OS=Xenopus tropicalis GN=ezh2 PE=2 SV=1 164 292 1.0E-17
sp|Q4V863|EZH2B_XENLA Histone-lysine N-methyltransferase EZH2 OS=Xenopus laevis GN=ezh2-b PE=2 SV=1 164 292 1.0E-17
sp|Q9NH52|MES4_CAEEL Histone-lysine N-methyltransferase mes-4 OS=Caenorhabditis elegans GN=mes-4 PE=1 SV=1 129 316 1.0E-17
sp|Q08BS4|EZH2_DANRE Histone-lysine N-methyltransferase EZH2 OS=Danio rerio GN=ezh2 PE=2 SV=1 165 292 1.0E-17
sp|Q6NRE8|SUV91_XENLA Histone-lysine N-methyltransferase SUV39H1 OS=Xenopus laevis GN=suv39h1 PE=2 SV=1 153 294 1.0E-17
sp|A7E2Z2|EZH1_BOVIN Histone-lysine N-methyltransferase EZH1 OS=Bos taurus GN=EZH1 PE=2 SV=2 164 292 2.0E-17
sp|P42124|EZ_DROME Histone-lysine N-methyltransferase E(z) OS=Drosophila melanogaster GN=E(z) PE=1 SV=2 165 307 2.0E-17
sp|Q2NL30|SUV91_BOVIN Histone-lysine N-methyltransferase SUV39H1 OS=Bos taurus GN=SUV39H1 PE=2 SV=1 153 294 2.0E-17
sp|Q5RB81|SUV91_PONAB Histone-lysine N-methyltransferase SUV39H1 OS=Pongo abelii GN=SUV39H1 PE=2 SV=1 153 294 2.0E-17
sp|O43463|SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens GN=SUV39H1 PE=1 SV=1 153 294 2.0E-17
sp|P70351|EZH1_MOUSE Histone-lysine N-methyltransferase EZH1 OS=Mus musculus GN=Ezh1 PE=1 SV=1 164 292 2.0E-17
sp|Q92800|EZH1_HUMAN Histone-lysine N-methyltransferase EZH1 OS=Homo sapiens GN=EZH1 PE=1 SV=2 164 292 2.0E-17
sp|O64827|SUVR5_ARATH Histone-lysine N-methyltransferase SUVR5 OS=Arabidopsis thaliana GN=SUVR5 PE=1 SV=3 153 315 3.0E-17
sp|Q9H5I1|SUV92_HUMAN Histone-lysine N-methyltransferase SUV39H2 OS=Homo sapiens GN=SUV39H2 PE=1 SV=2 153 315 3.0E-17
sp|Q4R3E0|SUV92_MACFA Histone-lysine N-methyltransferase SUV39H2 OS=Macaca fascicularis GN=SUV39H2 PE=2 SV=2 153 315 3.0E-17
sp|Q9EQQ0|SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus GN=Suv39h2 PE=1 SV=1 153 315 5.0E-17
sp|Q6DGD3|SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio GN=suv39h1a PE=2 SV=2 153 294 7.0E-17
sp|Q66J90|SET1B_XENLA Histone-lysine N-methyltransferase SETD1B OS=Xenopus laevis GN=setd1b PE=2 SV=1 154 315 1.0E-16
sp|Q5F3P8|SET1B_CHICK Histone-lysine N-methyltransferase SETD1B OS=Gallus gallus GN=SETD1B PE=2 SV=1 188 315 1.0E-16
sp|Q5RDS6|EZH1_PONAB Histone-lysine N-methyltransferase EZH1 OS=Pongo abelii GN=EZH1 PE=2 SV=1 164 292 1.0E-16
sp|O60016|CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr4 PE=1 SV=2 149 317 1.0E-16
sp|Q32PH7|SUV92_BOVIN Histone-lysine N-methyltransferase SUV39H2 OS=Bos taurus GN=SUV39H2 PE=2 SV=1 153 315 1.0E-16
sp|Q5F3W5|SUV92_CHICK Histone-lysine N-methyltransferase SUV39H2 OS=Gallus gallus GN=SUV39H2 PE=2 SV=1 153 294 2.0E-16
sp|Q1LY77|SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio GN=setd1ba PE=1 SV=2 169 315 2.0E-16
sp|Q9UPS6|SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens GN=SETD1B PE=1 SV=3 188 315 2.0E-16
sp|O54864|SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus GN=Suv39h1 PE=1 SV=1 161 294 2.0E-16
sp|O44757|LIN59_CAEEL Probable histone-lysine N-methyltransferase lin-59 OS=Caenorhabditis elegans GN=lin-59 PE=2 SV=1 138 317 2.0E-16
sp|Q08D57|SET1B_XENTR Histone-lysine N-methyltransferase SETD1B OS=Xenopus tropicalis GN=setd1b PE=2 SV=1 169 315 2.0E-16
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=3 168 315 2.0E-16
sp|Q8CFT2|SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus GN=Setd1b PE=1 SV=2 188 315 3.0E-16
sp|O08550|KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus GN=Kmt2b PE=1 SV=3 178 315 3.0E-16
sp|Q9ZSM8|EZA1_ARATH Histone-lysine N-methyltransferase EZA1 OS=Arabidopsis thaliana GN=EZA1 PE=1 SV=1 163 309 3.0E-16
sp|Q9UMN6|KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens GN=KMT2B PE=1 SV=1 178 315 3.0E-16
sp|Q80UJ9|SETMR_MOUSE Histone-lysine N-methyltransferase SETMAR OS=Mus musculus GN=Setmar PE=2 SV=2 161 315 3.0E-16
sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5 OS=Arabidopsis thaliana GN=ATX5 PE=2 SV=1 168 315 5.0E-16
sp|Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens GN=SETMAR PE=1 SV=2 125 315 5.0E-16
sp|Q95Y12|SET23_CAEEL Probable histone-lysine N-methyltransferase set-23 OS=Caenorhabditis elegans GN=set-23 PE=3 SV=1 120 315 8.0E-16
sp|Q5I0M0|SETMR_RAT Histone-lysine N-methyltransferase SETMAR OS=Rattus norvegicus GN=Setmar PE=2 SV=1 161 315 1.0E-15
sp|Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens GN=KMT2C PE=1 SV=3 169 311 2.0E-15
sp|Q8BRH4|KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus GN=Kmt2c PE=1 SV=2 169 311 2.0E-15
sp|P93831|CLF_ARATH Histone-lysine N-methyltransferase CLF OS=Arabidopsis thaliana GN=CLF PE=1 SV=2 165 309 3.0E-15
sp|Q0VD24|SETMR_BOVIN Histone-lysine N-methyltransferase SETMAR OS=Bos taurus GN=SETMAR PE=2 SV=1 81 315 4.0E-15
sp|Q8S4P5|EZ2_MAIZE Histone-lysine N-methyltransferase EZ2 OS=Zea mays GN=EZ2 PE=2 SV=1 165 309 5.0E-15
sp|Q8S4P4|EZ3_MAIZE Histone-lysine N-methyltransferase EZ3 OS=Zea mays GN=EZ3 PE=2 SV=1 165 309 6.0E-15
sp|O15047|SET1A_HUMAN Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens GN=SETD1A PE=1 SV=3 188 315 6.0E-15
sp|O65312|MEDEA_ARATH Histone-lysine N-methyltransferase MEDEA OS=Arabidopsis thaliana GN=MEA PE=1 SV=1 51 292 9.0E-15
sp|Q5LJZ2|SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster GN=Set1 PE=1 SV=1 169 316 1.0E-14
sp|P0CO26|SET1_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET1 PE=3 SV=1 169 315 1.0E-14
sp|P0CO27|SET1_CRYNB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET1 PE=3 SV=1 169 315 1.0E-14
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 125 315 2.0E-14
sp|Q8S4P6|EZ1_MAIZE Histone-lysine N-methyltransferase EZ1 OS=Zea mays GN=EZ1 PE=2 SV=1 165 313 2.0E-14
sp|P0CB22|ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana GN=ATX2 PE=2 SV=1 182 333 2.0E-14
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=2 168 315 2.0E-13
sp|Q6PDK2|KMT2D_MOUSE Histone-lysine N-methyltransferase 2D OS=Mus musculus GN=Kmt2d PE=1 SV=2 169 311 3.0E-13
sp|O14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D OS=Homo sapiens GN=KMT2D PE=1 SV=2 169 311 3.0E-13
sp|P45975|SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster GN=Su(var)3-9 PE=1 SV=2 187 311 2.0E-12
sp|Q9C5X4|ATX1_ARATH Histone-lysine N-methyltransferase ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2 166 327 3.0E-12
sp|C6KTD2|SET1_PLAF7 Putative histone-lysine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) GN=SET1 PE=2 SV=1 180 313 4.0E-12
sp|Q9SRV2|SUVR3_ARATH Histone-lysine N-methyltransferase SUVR3 OS=Arabidopsis thaliana GN=SUVR3 PE=2 SV=4 153 313 6.0E-12
sp|Q0V9E9|SETD8_XENTR N-lysine methyltransferase SETD8 OS=Xenopus tropicalis GN=setd8 PE=2 SV=1 186 292 7.0E-12
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 160 311 9.0E-12
sp|Q498E6|SET8B_XENLA N-lysine methyltransferase SETD8-B OS=Xenopus laevis GN=setd8-b PE=1 SV=1 186 292 1.0E-11
sp|Q08AY6|SET8A_XENLA N-lysine methyltransferase SETD8-A OS=Xenopus laevis GN=setd8-a PE=2 SV=1 186 292 2.0E-11
sp|O17514|MES2_CAEEL Histone-lysine N-methyltransferase mes-2 OS=Caenorhabditis elegans GN=mes-2 PE=1 SV=2 109 293 2.0E-11
sp|Q294B9|SUV39_DROPS Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila pseudoobscura pseudoobscura GN=Su(var)3-9 PE=3 SV=1 153 311 2.0E-11
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 125 311 4.0E-11
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 125 311 5.0E-11
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 125 313 6.0E-11
sp|Q9NQR1|SETD8_HUMAN N-lysine methyltransferase SETD8 OS=Homo sapiens GN=SETD8 PE=1 SV=3 184 293 2.0E-10
sp|Q2YDW7|SETD8_MOUSE N-lysine methyltransferase SETD8 OS=Mus musculus GN=Setd8 PE=1 SV=1 184 292 2.0E-10
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 160 311 4.0E-10
sp|Q2YDJ8|SETD8_BOVIN N-lysine methyltransferase SETD8 OS=Bos taurus GN=SETD8 PE=2 SV=1 184 292 4.0E-10
sp|Q1L8U8|STB1A_DANRE Histone-lysine N-methyltransferase SETDB1-A OS=Danio rerio GN=setdb1a PE=3 SV=1 240 313 2.0E-09
sp|Q28Z18|SETB1_DROPS Histone-lysine N-methyltransferase eggless OS=Drosophila pseudoobscura pseudoobscura GN=egg PE=3 SV=2 232 311 3.0E-09
sp|Q08BR4|STB1B_DANRE Histone-lysine N-methyltransferase SETDB1-B OS=Danio rerio GN=setdb1b PE=2 SV=2 230 322 4.0E-09
sp|Q8W595|SUVR4_ARATH Histone-lysine N-methyltransferase SUVR4 OS=Arabidopsis thaliana GN=SUVR4 PE=1 SV=2 153 311 4.0E-09
sp|Q6INA9|SETB1_XENLA Histone-lysine N-methyltransferase SETDB1 OS=Xenopus laevis GN=setdb1 PE=2 SV=1 240 313 4.0E-09
sp|Q071E0|SET8A_DANRE N-lysine methyltransferase SETD8-A OS=Danio rerio GN=setd8a PE=2 SV=1 186 292 5.0E-09
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 161 311 6.0E-09
sp|Q32KD2|SETB1_DROME Histone-lysine N-methyltransferase eggless OS=Drosophila melanogaster GN=egg PE=1 SV=1 240 311 8.0E-09
sp|P34544|MET2_CAEEL Histone-lysine N-methyltransferase met-2 OS=Caenorhabditis elegans GN=met-2 PE=3 SV=5 241 313 1.0E-08
sp|O88974|SETB1_MOUSE Histone-lysine N-methyltransferase SETDB1 OS=Mus musculus GN=Setdb1 PE=1 SV=1 240 313 1.0E-08
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 114 313 2.0E-08
sp|Q15047|SETB1_HUMAN Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens GN=SETDB1 PE=1 SV=1 240 313 2.0E-08
sp|Q8X225|DIM5_NEUCR Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dim-5 PE=1 SV=2 153 315 5.0E-08
sp|Q946J2|SUVR1_ARATH Probable inactive histone-lysine N-methyltransferase SUVR1 OS=Arabidopsis thaliana GN=SUVR1 PE=1 SV=2 146 311 6.0E-08
sp|Q6YI93|SETB2_XENLA Histone-lysine N-methyltransferase SETDB2 OS=Xenopus laevis GN=setdb2 PE=2 SV=2 239 311 2.0E-07
sp|Q9VFK6|SETD8_DROME Histone-lysine N-methyltransferase pr-set7 OS=Drosophila melanogaster GN=pr-set7 PE=1 SV=2 186 292 2.0E-07
sp|A4IGY9|SETB2_XENTR Histone-lysine N-methyltransferase SETDB2 OS=Xenopus tropicalis GN=setdb2 PE=2 SV=1 239 311 3.0E-07
sp|O23372|ATXR3_ARATH Histone-lysine N-methyltransferase ATXR3 OS=Arabidopsis thaliana GN=ATXR3 PE=2 SV=2 185 313 1.0E-06
sp|Q297V5|SETD8_DROPS Histone-lysine N-methyltransferase pr-set7 OS=Drosophila pseudoobscura pseudoobscura GN=pr-set7 PE=3 SV=2 186 292 1.0E-06
sp|Q8C267|SETB2_MOUSE Histone-lysine N-methyltransferase SETDB2 OS=Mus musculus GN=Setdb2 PE=2 SV=2 220 311 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005694 chromosome Yes
GO:0005634 nucleus Yes
GO:0018024 histone-lysine N-methyltransferase activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005515 protein binding Yes
GO:0034968 histone lysine methylation Yes
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0008168 methyltransferase activity No
GO:0044267 cellular protein metabolic process No
GO:0018205 peptidyl-lysine modification No
GO:0016570 histone modification No
GO:0050794 regulation of cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0008276 protein methyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0008170 N-methyltransferase activity No
GO:0006479 protein methylation No
GO:0010468 regulation of gene expression No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0036211 protein modification process No
GO:0016279 protein-lysine N-methyltransferase activity No
GO:0043226 organelle No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0042054 histone methyltransferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0016571 histone methylation No
GO:0043414 macromolecule methylation No
GO:0016278 lysine N-methyltransferase activity No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0071840 cellular component organization or biogenesis No
GO:0003824 catalytic activity No
GO:0016043 cellular component organization No
GO:0016569 covalent chromatin modification No
GO:0050789 regulation of biological process No
GO:0044424 intracellular part No
GO:0018022 peptidyl-lysine methylation No
GO:0018193 peptidyl-amino acid modification No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:0006464 cellular protein modification process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0043412 macromolecule modification No
GO:0140096 catalytic activity, acting on a protein No
GO:0043229 intracellular organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0032259 methylation No
GO:0006325 chromatin organization No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044464 cell part No
GO:0008213 protein alkylation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0019538 protein metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10323
MEDDEHAPSGMSRLKLEDAAANGAPPAPDPGASVAPADARHDTFPSPVPSLDGLKSRSDSVETPGPAKPARPVRK
TSQKLPGREPPLFAHLPDVTAQSCETFQVIADCLYGSKHLGSTDNDALDCDCRDEWRDGENCACGDDSDCINRAT
KMECSASGGNCAGGCQNQRFQRKQWATVSVIKTDKKGFGLRADADLHPNDFVYEYIGEVINEPTFRRRMLQYDRE
GIKHFYFMSLSKSEFVDATKKGNLGRFCNHSCSPNCYVDKWVVGDKLRMGVFALRRIRAGEELVFNYNVDRYGAD
PQPCYCGEPNCVGFIGGKTQTERATKLPAATVEALGIDDADGWDTAVAKKPRKKRPDEDDEEYVNSIQPRGLDDD
DARKVMAALMQCKEKWIAVKLLERIQRCDDERAIHCVMRMHAYQILKTTLNTFIHDHNVVLQVLEILDKLPRLTR
NKIQDSNIEAAVEALAASDHQDVASRSRKLLEAWSKLELAYRIRRRKVDPNAPVQHVYEDRRGGQQSREEETAQS
TPKTASPRTIDAPKGPRSSVPQRNNSFYYGGQRPRRQMHAPLPDGWFAAKDGRGKTYFYTKSGNTTWQRPTHPAA
ESIQKGPSKAMQEQLAIQSIIDKVTKEGTPKQPAPAQPREVSETPSKESKKDKWRSLPIDKQMRIYENTVFPPVK
YVLDKFRHKLPKEELKRLGKDIAKKLVASDYKNNRVEDPTAELTDKQVLKIKKFVSDFLNRAVEKYQAHQRRKAS
RSKQSGAGETDGGEAPGGRPQPDGDGGRDSGTDVPAAKTEDLADENMLSDVDVDSPGSQDRKRKREMDLVDSTDA
TPSEGPDAKRVKDDEASPPPPPPPPPETAPEDEMTEAQRAFREQEEALMRENEEAQRLEDEANKSKMMEGAVADE
MRKNIPLAV*
Coding >Hirsu2|10323
ATGGAGGATGACGAGCATGCACCGAGCGGCATGAGCAGGTTGAAGCTCGAGGACGCTGCCGCCAATGGCGCGCCT
CCCGCCCCCGACCCGGGCGCCTCTGTCGCGCCCGCCGACGCGCGCCACGACACGTTTCCCTCCCCCGTGCCCTCG
CTCGACGGCCTCAAGTCTCGCAGCGACAGCGTCGAGACGCCCGGCCCGGCAAAGCCCGCCCGCCCGGTCCGCAAG
ACGTCGCAGAAGCTGCCAGGCCGCGAGCCCCCGTTGTTTGCCCACCTGCCCGACGTCACCGCCCAGTCGTGCGAG
ACCTTTCAGGTCATCGCCGACTGCCTCTACGGCTCCAAGCACCTGGGCTCCACCGACAACGATGCCCTCGACTGC
GACTGCCGCGACGAATGGCGCGACGGCGAGAACTGTGCCTGCGGCGACGACTCCGACTGCATCAACCGCGCCACC
AAGATGGAGTGCAGCGCCAGCGGCGGCAACTGCGCCGGCGGCTGCCAGAACCAGCGCTTCCAGCGCAAGCAGTGG
GCCACCGTCTCCGTCATCAAGACGGACAAGAAGGGCTTCGGCCTCCGCGCCGACGCCGACCTGCACCCCAACGAC
TTCGTCTACGAGTACATCGGCGAGGTCATCAACGAGCCCACCTTCCGCCGCCGCATGCTGCAGTACGACCGCGAG
GGCATCAAGCACTTCTACTTCATGTCCCTCAGCAAGAGCGAGTTCGTCGACGCCACCAAAAAGGGCAACCTCGGC
CGCTTCTGCAACCACTCCTGCAGCCCCAACTGCTACGTTGACAAGTGGGTGGTCGGCGACAAGCTCCGCATGGGC
GTCTTCGCCCTGCGCAGGATCCGCGCCGGCGAGGAGCTCGTCTTCAACTACAACGTCGACCGCTACGGCGCCGAC
CCCCAGCCCTGCTACTGCGGCGAGCCCAACTGCGTCGGCTTCATCGGCGGCAAGACGCAGACGGAGCGCGCCACC
AAGCTGCCCGCCGCCACCGTCGAGGCCCTCGGCATCGACGACGCCGACGGCTGGGACACGGCCGTCGCCAAGAAG
CCGCGCAAGAAGCGGCCCGACGAGGACGACGAGGAGTACGTCAACAGCATCCAGCCCCGCGGCCTCGACGACGAC
GACGCCCGCAAGGTCATGGCCGCCCTCATGCAGTGTAAGGAGAAGTGGATCGCCGTCAAGCTGCTTGAGCGCATC
CAGCGCTGCGACGACGAGCGCGCCATCCACTGCGTCATGCGCATGCACGCCTACCAGATCCTCAAGACGACGCTC
AACACCTTCATCCACGACCACAACGTGGTGCTGCAGGTGCTCGAGATCCTCGACAAGCTGCCCCGTCTGACGAGG
AACAAGATCCAGGACTCCAACATCGAGGCCGCCGTCGAGGCCCTGGCCGCCTCGGACCACCAGGACGTGGCCTCG
AGGTCCAGGAAGCTGCTCGAGGCCTGGAGCAAGCTCGAGCTGGCCTACCGCATCCGCCGCCGCAAGGTCGACCCC
AACGCCCCGGTCCAGCACGTGTACGAGGACCGCCGAGGCGGCCAGCAGTCCCGCGAGGAGGAGACGGCCCAGTCG
ACGCCCAAGACGGCCTCGCCCCGCACCATCGACGCCCCCAAGGGCCCGCGCAGCAGCGTCCCGCAGCGCAACAAC
TCCTTCTACTACGGCGGCCAGCGGCCGCGCCGGCAGATGCACGCGCCCCTGCCCGACGGCTGGTTCGCCGCCAAG
GACGGCAGGGGCAAGACGTACTTCTACACCAAGTCGGGCAACACCACCTGGCAGCGGCCGACCCACCCGGCCGCC
GAGTCGATCCAGAAGGGGCCGTCCAAGGCGATGCAGGAGCAGCTGGCCATCCAGAGCATCATCGACAAGGTCACC
AAGGAGGGCACCCCGAAGCAGCCGGCTCCGGCGCAGCCGAGGGAAGTCTCGGAGACGCCGTCCAAGGAGTCAAAG
AAGGACAAGTGGCGGTCGCTGCCGATTGACAAGCAGATGAGGATATACGAAAACACGGTGTTCCCCCCGGTCAAG
TACGTGCTCGACAAGTTCCGGCACAAGCTGCCCAAGGAGGAGCTCAAGAGGTTGGGCAAAGACATCGCCAAGAAG
CTGGTCGCGTCCGACTACAAGAACAACCGGGTCGAGGACCCCACGGCCGAGCTCACGGACAAGCAAGTGTTGAAG
ATTAAGAAGTTCGTCTCGGACTTTTTGAATCGCGCCGTCGAGAAGTACCAGGCACACCAGAGGCGGAAGGCGTCG
AGGTCGAAGCAGTCCGGCGCCGGGGAGACGGACGGCGGGGAGGCGCCGGGCGGCAGGCCGCAGCCGGACGGAGAC
GGCGGCCGGGACAGCGGGACCGACGTGCCGGCGGCCAAGACGGAGGACCTCGCCGACGAGAACATGCTCAGCGAC
GTCGACGTCGATTCGCCCGGCAGTCAGGACCGCAAGCGGAAACGCGAGATGGACCTGGTGGACTCGACGGACGCG
ACGCCATCGGAAGGCCCCGACGCCAAGAGGGTCAAGGACGACGAGGCGAGCCCGCCGCCGCCGCCGCCGCCGCCT
CCCGAGACGGCGCCGGAGGACGAGATGACGGAGGCGCAGCGAGCGTTCCGGGAGCAGGAGGAAGCGCTGATGCGA
GAGAACGAGGAGGCGCAGAGGCTAGAAGACGAAGCCAACAAGTCCAAGATGATGGAGGGGGCTGTGGCCGACGAG
ATGCGCAAAAACATACCTCTCGCGGTATGA
Transcript >Hirsu2|10323
ATGGAGGATGACGAGCATGCACCGAGCGGCATGAGCAGGTTGAAGCTCGAGGACGCTGCCGCCAATGGCGCGCCT
CCCGCCCCCGACCCGGGCGCCTCTGTCGCGCCCGCCGACGCGCGCCACGACACGTTTCCCTCCCCCGTGCCCTCG
CTCGACGGCCTCAAGTCTCGCAGCGACAGCGTCGAGACGCCCGGCCCGGCAAAGCCCGCCCGCCCGGTCCGCAAG
ACGTCGCAGAAGCTGCCAGGCCGCGAGCCCCCGTTGTTTGCCCACCTGCCCGACGTCACCGCCCAGTCGTGCGAG
ACCTTTCAGGTCATCGCCGACTGCCTCTACGGCTCCAAGCACCTGGGCTCCACCGACAACGATGCCCTCGACTGC
GACTGCCGCGACGAATGGCGCGACGGCGAGAACTGTGCCTGCGGCGACGACTCCGACTGCATCAACCGCGCCACC
AAGATGGAGTGCAGCGCCAGCGGCGGCAACTGCGCCGGCGGCTGCCAGAACCAGCGCTTCCAGCGCAAGCAGTGG
GCCACCGTCTCCGTCATCAAGACGGACAAGAAGGGCTTCGGCCTCCGCGCCGACGCCGACCTGCACCCCAACGAC
TTCGTCTACGAGTACATCGGCGAGGTCATCAACGAGCCCACCTTCCGCCGCCGCATGCTGCAGTACGACCGCGAG
GGCATCAAGCACTTCTACTTCATGTCCCTCAGCAAGAGCGAGTTCGTCGACGCCACCAAAAAGGGCAACCTCGGC
CGCTTCTGCAACCACTCCTGCAGCCCCAACTGCTACGTTGACAAGTGGGTGGTCGGCGACAAGCTCCGCATGGGC
GTCTTCGCCCTGCGCAGGATCCGCGCCGGCGAGGAGCTCGTCTTCAACTACAACGTCGACCGCTACGGCGCCGAC
CCCCAGCCCTGCTACTGCGGCGAGCCCAACTGCGTCGGCTTCATCGGCGGCAAGACGCAGACGGAGCGCGCCACC
AAGCTGCCCGCCGCCACCGTCGAGGCCCTCGGCATCGACGACGCCGACGGCTGGGACACGGCCGTCGCCAAGAAG
CCGCGCAAGAAGCGGCCCGACGAGGACGACGAGGAGTACGTCAACAGCATCCAGCCCCGCGGCCTCGACGACGAC
GACGCCCGCAAGGTCATGGCCGCCCTCATGCAGTGTAAGGAGAAGTGGATCGCCGTCAAGCTGCTTGAGCGCATC
CAGCGCTGCGACGACGAGCGCGCCATCCACTGCGTCATGCGCATGCACGCCTACCAGATCCTCAAGACGACGCTC
AACACCTTCATCCACGACCACAACGTGGTGCTGCAGGTGCTCGAGATCCTCGACAAGCTGCCCCGTCTGACGAGG
AACAAGATCCAGGACTCCAACATCGAGGCCGCCGTCGAGGCCCTGGCCGCCTCGGACCACCAGGACGTGGCCTCG
AGGTCCAGGAAGCTGCTCGAGGCCTGGAGCAAGCTCGAGCTGGCCTACCGCATCCGCCGCCGCAAGGTCGACCCC
AACGCCCCGGTCCAGCACGTGTACGAGGACCGCCGAGGCGGCCAGCAGTCCCGCGAGGAGGAGACGGCCCAGTCG
ACGCCCAAGACGGCCTCGCCCCGCACCATCGACGCCCCCAAGGGCCCGCGCAGCAGCGTCCCGCAGCGCAACAAC
TCCTTCTACTACGGCGGCCAGCGGCCGCGCCGGCAGATGCACGCGCCCCTGCCCGACGGCTGGTTCGCCGCCAAG
GACGGCAGGGGCAAGACGTACTTCTACACCAAGTCGGGCAACACCACCTGGCAGCGGCCGACCCACCCGGCCGCC
GAGTCGATCCAGAAGGGGCCGTCCAAGGCGATGCAGGAGCAGCTGGCCATCCAGAGCATCATCGACAAGGTCACC
AAGGAGGGCACCCCGAAGCAGCCGGCTCCGGCGCAGCCGAGGGAAGTCTCGGAGACGCCGTCCAAGGAGTCAAAG
AAGGACAAGTGGCGGTCGCTGCCGATTGACAAGCAGATGAGGATATACGAAAACACGGTGTTCCCCCCGGTCAAG
TACGTGCTCGACAAGTTCCGGCACAAGCTGCCCAAGGAGGAGCTCAAGAGGTTGGGCAAAGACATCGCCAAGAAG
CTGGTCGCGTCCGACTACAAGAACAACCGGGTCGAGGACCCCACGGCCGAGCTCACGGACAAGCAAGTGTTGAAG
ATTAAGAAGTTCGTCTCGGACTTTTTGAATCGCGCCGTCGAGAAGTACCAGGCACACCAGAGGCGGAAGGCGTCG
AGGTCGAAGCAGTCCGGCGCCGGGGAGACGGACGGCGGGGAGGCGCCGGGCGGCAGGCCGCAGCCGGACGGAGAC
GGCGGCCGGGACAGCGGGACCGACGTGCCGGCGGCCAAGACGGAGGACCTCGCCGACGAGAACATGCTCAGCGAC
GTCGACGTCGATTCGCCCGGCAGTCAGGACCGCAAGCGGAAACGCGAGATGGACCTGGTGGACTCGACGGACGCG
ACGCCATCGGAAGGCCCCGACGCCAAGAGGGTCAAGGACGACGAGGCGAGCCCGCCGCCGCCGCCGCCGCCGCCT
CCCGAGACGGCGCCGGAGGACGAGATGACGGAGGCGCAGCGAGCGTTCCGGGAGCAGGAGGAAGCGCTGATGCGA
GAGAACGAGGAGGCGCAGAGGCTAGAAGACGAAGCCAACAAGTCCAAGATGATGGAGGGGGCTGTGGCCGACGAG
ATGCGCAAAAACATACCTCTCGCGGTATGA
Gene >Hirsu2|10323
ATGGAGGATGACGAGCATGCACCGAGCGGCATGAGCAGGTTGAAGCTCGAGGACGCTGCCGCCAATGGCGCGCCT
CCCGCCCCCGACCCGGGCGCCTCTGTCGCGCCCGCCGACGCGCGCCACGACACGTTTCCCTCCCCCGTGCCCTCG
CTCGACGGCCTCAAGTCTCGCAGCGACAGCGTCGAGACGCCCGGCCCGGCAAAGCCCGCCCGCCCGGTCCGCAAG
ACGTCGCAGAAGCTGCCAGGCCGCGAGCCCCCGTTGTTTGCCCACCTGCCCGACGTCACCGCCCAGTCGTGCGAG
ACCTTTCAGGTCATCGCCGACTGCCTCTACGGCTCCAAGCACCTGGGCTCCACCGACAACGATGCCCTCGACTGC
GACTGCCGCGACGAATGGCGTACGCGTCTCCCCTCCCCCCCGTCCCGTCCCATCCGCTGGCCGTCTGCCCTGCCC
GGCAAGCCGCTGACCTGACCCCCTTCCGTCCCGCAGGCGACGGCGAGAACTGTGCCTGCGGCGACGACTCCGACT
GCATCAACCGCGCCACCAAGATGGAGTGCAGCGCCAGCGGCGGCAACTGCGCCGGCGGCTGCCAGAACCAGCGCT
TCCAGCGCAAGCAGTGGGCCACCGTCTCCGTCATCAAGACGGACAAGAAGGGCTTCGGCCTCCGCGCCGACGCCG
ACCTGCACCCCAACGACTTCGTCTACGAGTACATCGGCGAGGTCATCAACGAGCCCACCTTCCGCCGCCGCATGC
TGCAGTACGACCGCGAGGGCATCAAGCACTTCTACTTCATGTCCCTCAGCAAGAGCGAGTTCGTCGACGCCACCA
AAAAGGGCAACCTCGGCCGCTTCTGCAACCACTCCTGCAGCCCCAACTGCTACGTTGACAAGTGGGTGGTCGGCG
ACAAGCTCCGCATGGGCGTCTTCGCCCTGCGCAGGATCCGCGCCGGCGAGGAGCTCGTCTTCAACTACAACGTCG
ACCGCTACGGCGCCGACCCCCAGCCCTGCTACTGCGGCGAGCCCAACTGCGTCGGCTTCATCGGCGGCAAGACGC
AGACGGAGCGCGCCACCAAGCTGCCCGCCGCCACCGTCGAGGCCCTCGGCATCGACGACGCCGACGGCTGGGACA
CGGCCGTCGCCAAGAAGCCGCGCAAGAAGCGGCCCGACGAGGACGACGAGGAGTACGTCAACAGCATCCAGCCCC
GCGGCCTCGACGACGACGACGCCCGCAAGGTCATGGCCGCCCTCATGCAGTGTAAGGAGAAGTGGATCGCCGTCA
AGCTGCTTGAGCGCATCCAGCGCTGCGACGACGAGCGCGCCATCCACTGCGTCATGCGCATGCACGCCTACCAGA
TCCTCAAGACGACGCTCAACACCTTCATCCACGACCACAACGTGGTGCTGCAGGTGCTCGAGATCCTCGACAAGC
TGCCCCGTCTGACGAGGAACAAGATCCAGGACTCCAACATCGAGGCCGCCGTCGAGGCCCTGGCCGCCTCGGACC
ACCAGGACGTGGCCTCGAGGTCCAGGAAGCTGCTCGAGGCCTGGAGCAAGCTCGAGCTGGCCTACCGCATCCGCC
GCCGCAAGGTCGACCCCAACGCCCCGGTCCAGCACGTGTACGAGGACCGCCGAGGCGGCCAGCAGTCCCGCGAGG
AGGAGACGGCCCAGTCGACGCCCAAGACGGCCTCGCCCCGCACCATCGACGCCCCCAAGGGCCCGCGCAGCAGCG
TCCCGCAGCGCAACAACTCCTTCTACTACGGCGGCCAGCGGCCGCGCCGGCAGATGCACGCGCCCCTGCCCGACG
GCTGGTTCGCCGCCAAGGACGGCAGGGGCAAGACGTACTTCTACACCAAGTCGGGCAACACCACCTGGCAGCGGC
CGACCCACCCGGCCGCCGAGTCGATCCAGAAGGGGCCGTCCAAGGCGATGCAGGAGCAGCTGGCCATCCAGAGCA
TCATCGACAAGGTCACCAAGGAGGGCACCCCGAAGCAGCCGGCTCCGGCGCAGCCGAGGGAAGTCTCGGAGACGC
CGTCCAAGGAGTCAAAGAAGGACAAGTGGCGGTCGCTGCCGATTGACAAGCAGATGAGGATATACGAAAACACGG
TAAGCATGCTGCACCCGTCGAGCCCCCTCCCCCGCTGACGGGAAAAAAAAACAACACCAGGTGTTCCCCCCGGTC
AAGTACGTGCTCGACAAGTTCCGGCACAAGCTGCCCAAGGAGGAGCTCAAGAGGTTGGGCAAAGACATCGCCAAG
AAGCTGGTCGCGTCCGACTACAAGAACAACCGGGTCGAGGACCCCACGGCCGAGCTCACGGACAAGCAAGTGTTG
AAGATTAAGAAGTTCGTCTCGGACTTTTTGAATCGCGCCGTCGAGAAGTACCAGGCACACCAGAGGCGGAAGGCG
TCGAGGTCGAAGCAGTCCGGCGCCGGGGAGACGGACGGCGGGGAGGCGCCGGGCGGCAGGCCGCAGCCGGACGGA
GACGGCGGCCGGGACAGCGGGACCGACGTGCCGGCGGCCAAGACGGAGGACCTCGCCGACGAGAACATGCTCAGC
GACGTCGACGTCGATTCGCCCGGCAGTCAGGACCGCAAGCGGAAACGCGAGATGGACCTGGTGGACTCGACGGAC
GCGACGCCATCGGAAGGCCCCGACGCCAAGAGGGTCAAGGACGACGAGGCGAGCCCGCCGCCGCCGCCGCCGCCG
CCTCCCGAGACGGCGCCGGAGGACGAGATGACGGAGGCGCAGCGAGCGTTCCGGGAGCAGGAGGAAGCGCTGATG
CGAGAGAACGAGGAGGCGCAGAGGCTAGAAGACGAAGCCAACAAGTCCAAGATGATGGAGGGGGCTGTGGCCGAC
GAGATGCGCAAAAACATACCTCTCGCGGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail