Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10323
Gene name
LocationContig_822:943..3826
Strand-
Gene length (bp)2883
Transcript length (bp)2730
Coding sequence length (bp)2730
Protein length (aa) 910

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08236 SRI SRI (Set2 Rpb1 interacting) domain 1.5E-21 660 742
PF00856 SET SET domain 5.2E-18 187 293
PF17907 AWS AWS domain 2.8E-08 133 173
PF08711 Med26 TFIIS helical bundle-like domain 1.5E-05 439 486

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB50|SET2_GIBZE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET2 PE=3 SV=2 11 897 0.0E+00
sp|Q7RZU4|SET2_NEUCR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-2 PE=3 SV=1 1 886 0.0E+00
sp|Q2H988|SET2_CHAGB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET2 PE=3 SV=1 50 896 0.0E+00
sp|Q1DU03|SET2_COCIM Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Coccidioides immitis (strain RS) GN=SET2 PE=3 SV=2 66 781 0.0E+00
sp|Q4WTT2|SET2_ASPFU Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set2 PE=3 SV=1 66 819 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB50|SET2_GIBZE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET2 PE=3 SV=2 11 897 0.0E+00
sp|Q7RZU4|SET2_NEUCR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-2 PE=3 SV=1 1 886 0.0E+00
sp|Q2H988|SET2_CHAGB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET2 PE=3 SV=1 50 896 0.0E+00
sp|Q1DU03|SET2_COCIM Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Coccidioides immitis (strain RS) GN=SET2 PE=3 SV=2 66 781 0.0E+00
sp|Q4WTT2|SET2_ASPFU Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set2 PE=3 SV=1 66 819 0.0E+00
sp|Q2UTN6|SET2_ASPOR Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set2 PE=3 SV=1 66 814 0.0E+00
sp|Q5ASA5|SET2_EMENI Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set2 PE=3 SV=1 66 774 0.0E+00
sp|O14026|SET2_SCHPO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set2 PE=1 SV=1 85 503 1.0E-145
sp|Q6C5G5|SET2_YARLI Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=set-2 PE=3 SV=1 80 742 6.0E-138
sp|Q6CXP5|SET2_KLULA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET2 PE=3 SV=1 83 738 9.0E-133
sp|Q6BM04|SET2_DEBHA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET2 PE=3 SV=2 85 607 1.0E-130
sp|Q6FX50|SET2_CANGA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET2 PE=3 SV=1 78 747 2.0E-128
sp|P46995|SET2_YEAST Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET2 PE=1 SV=2 82 735 3.0E-120
sp|Q757Y8|SET2_ASHGO Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET2 PE=3 SV=2 87 740 2.0E-114
sp|Q59XV0|SET2_CANAL Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET2 PE=3 SV=1 85 595 2.0E-113
sp|P0CO28|SET2_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET2 PE=3 SV=1 84 495 7.0E-113
sp|P0CO29|SET2_CRYNB Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET2 PE=3 SV=1 84 495 8.0E-113
sp|Q4PBL3|SET2_USTMA Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET2 PE=3 SV=1 81 496 9.0E-100
sp|Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens GN=SETD2 PE=1 SV=3 102 463 4.0E-57
sp|E9Q5F9|SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus GN=Setd2 PE=1 SV=1 102 458 4.0E-57
sp|Q9VYD1|C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster GN=Set2 PE=1 SV=2 96 327 1.0E-50
sp|Q2LAE1|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana GN=ASHH2 PE=1 SV=1 118 399 9.0E-46
sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 139 316 2.0E-44
sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 139 316 2.0E-43
sp|Q84WW6|ASHH1_ARATH Histone-lysine N-methyltransferase ASHH1 OS=Arabidopsis thaliana GN=ASHH1 PE=1 SV=1 113 320 2.0E-42
sp|O96028|NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens GN=WHSC1 PE=1 SV=1 110 321 1.0E-41
sp|Q8BVE8|NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus GN=Whsc1 PE=1 SV=2 139 321 1.0E-41
sp|Q6P2L6|NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 125 316 5.0E-41
sp|Q9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens GN=WHSC1L1 PE=1 SV=1 139 316 1.0E-40
sp|Q99MY8|ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus GN=Ash1l PE=1 SV=3 121 329 1.0E-38
sp|Q9NR48|ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens GN=ASH1L PE=1 SV=2 121 320 3.0E-37
sp|Q8MT36|MES4_DROME Probable histone-lysine N-methyltransferase Mes-4 OS=Drosophila melanogaster GN=Mes-4 PE=1 SV=2 139 320 8.0E-37
sp|Q949T8|ASHR3_ARATH Histone-lysine N-methyltransferase ASHR3 OS=Arabidopsis thaliana GN=ASHR3 PE=1 SV=1 128 353 1.0E-36
sp|Q9VW15|ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster GN=ash1 PE=1 SV=3 125 407 8.0E-35
sp|Q9M1X9|ASHH4_ARATH Putative histone-lysine N-methyltransferase ASHH4 OS=Arabidopsis thaliana GN=ASHH4 PE=3 SV=1 167 331 5.0E-31
sp|Q945S8|ASHH3_ARATH Histone-lysine N-methyltransferase ASHH3 OS=Arabidopsis thaliana GN=ASHH3 PE=2 SV=2 167 311 9.0E-29
sp|Q8IE95|SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) GN=SETVS PE=2 SV=1 102 332 5.0E-26
sp|Q75D88|SET1_ASHGO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET1 PE=3 SV=2 110 315 8.0E-24
sp|Q9Y7R4|SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set1 PE=1 SV=1 188 316 1.0E-22
sp|P38827|SET1_YEAST Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET1 PE=1 SV=1 167 316 1.0E-22
sp|Q6FKB1|SET1_CANGA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET1 PE=3 SV=1 155 316 5.0E-22
sp|Q2UMH3|SET1_ASPOR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set1 PE=3 SV=1 167 315 8.0E-22
sp|Q5B0Y5|SET1_EMENI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set1 PE=3 SV=1 149 315 2.0E-21
sp|Q4WNH8|SET1_ASPFU Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set1 PE=3 SV=1 167 315 2.0E-21
sp|Q1DR06|SET1_COCIM Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Coccidioides immitis (strain RS) GN=SET1 PE=3 SV=1 167 315 3.0E-21
sp|Q6CEK8|SET1_YARLI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SET1 PE=3 SV=1 172 315 6.0E-21
sp|F4K1J4|ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana GN=ATXR7 PE=2 SV=1 188 314 7.0E-21
sp|Q4PB36|SET1_USTMA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET1 PE=3 SV=1 188 315 2.0E-20
sp|Q8X0S9|SET1_NEUCR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-1 PE=3 SV=1 167 315 2.0E-20
sp|Q4I5R3|SET1_GIBZE Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET1 PE=3 SV=2 167 316 4.0E-20
sp|Q8IRW8|TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster GN=trr PE=1 SV=2 172 311 4.0E-20
sp|Q18221|SET2_CAEEL Probable histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans GN=set-2 PE=2 SV=2 163 316 1.0E-19
sp|Q2GWF3|SET1_CHAGB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET1 PE=3 SV=1 167 315 2.0E-19
sp|Q54HS3|SET1_DICDI Histone-lysine N-methyltransferase set1 OS=Dictyostelium discoideum GN=set1 PE=1 SV=1 157 311 2.0E-19
sp|Q6CIT4|SET1_KLULA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET1 PE=3 SV=1 167 316 3.0E-19
sp|Q5ABG1|SET1_CANAL Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET1 PE=3 SV=1 178 316 4.0E-19
sp|Q6BKL7|SET1_DEBHA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET1 PE=3 SV=2 178 316 6.0E-19
sp|Q28CQ7|SUV92_XENTR Histone-lysine N-methyltransferase SUV39H2 OS=Xenopus tropicalis GN=suv39h2 PE=2 SV=2 153 315 7.0E-19
sp|Q24742|TRX_DROVI Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis GN=trx PE=3 SV=1 178 315 8.0E-19
sp|P55200|KMT2A_MOUSE Histone-lysine N-methyltransferase 2A OS=Mus musculus GN=Kmt2a PE=1 SV=3 178 315 2.0E-18
sp|Q03164|KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens GN=KMT2A PE=1 SV=5 178 315 2.0E-18
sp|P20659|TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster GN=trx PE=1 SV=4 178 315 3.0E-18
sp|Q98SM3|EZH2A_XENLA Histone-lysine N-methyltransferase EZH2 OS=Xenopus laevis GN=ezh2-a PE=2 SV=1 164 292 3.0E-18
sp|A8XI75|SET23_CAEBR Probable histone-lysine N-methyltransferase set-23 OS=Caenorhabditis briggsae GN=set-23 PE=3 SV=1 125 315 8.0E-18
sp|Q4R381|EZH2_MACFA Histone-lysine N-methyltransferase EZH2 OS=Macaca fascicularis GN=EZH2 PE=2 SV=1 164 292 9.0E-18
sp|Q15910|EZH2_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens GN=EZH2 PE=1 SV=2 164 292 9.0E-18
sp|Q61188|EZH2_MOUSE Histone-lysine N-methyltransferase EZH2 OS=Mus musculus GN=Ezh2 PE=1 SV=2 164 292 1.0E-17
sp|Q28D84|EZH2_XENTR Histone-lysine N-methyltransferase EZH2 OS=Xenopus tropicalis GN=ezh2 PE=2 SV=1 164 292 1.0E-17
sp|Q4V863|EZH2B_XENLA Histone-lysine N-methyltransferase EZH2 OS=Xenopus laevis GN=ezh2-b PE=2 SV=1 164 292 1.0E-17
sp|Q9NH52|MES4_CAEEL Histone-lysine N-methyltransferase mes-4 OS=Caenorhabditis elegans GN=mes-4 PE=1 SV=1 129 316 1.0E-17
sp|Q08BS4|EZH2_DANRE Histone-lysine N-methyltransferase EZH2 OS=Danio rerio GN=ezh2 PE=2 SV=1 165 292 1.0E-17
sp|Q6NRE8|SUV91_XENLA Histone-lysine N-methyltransferase SUV39H1 OS=Xenopus laevis GN=suv39h1 PE=2 SV=1 153 294 1.0E-17
sp|A7E2Z2|EZH1_BOVIN Histone-lysine N-methyltransferase EZH1 OS=Bos taurus GN=EZH1 PE=2 SV=2 164 292 2.0E-17
sp|P42124|EZ_DROME Histone-lysine N-methyltransferase E(z) OS=Drosophila melanogaster GN=E(z) PE=1 SV=2 165 307 2.0E-17
sp|Q2NL30|SUV91_BOVIN Histone-lysine N-methyltransferase SUV39H1 OS=Bos taurus GN=SUV39H1 PE=2 SV=1 153 294 2.0E-17
sp|Q5RB81|SUV91_PONAB Histone-lysine N-methyltransferase SUV39H1 OS=Pongo abelii GN=SUV39H1 PE=2 SV=1 153 294 2.0E-17
sp|O43463|SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens GN=SUV39H1 PE=1 SV=1 153 294 2.0E-17
sp|P70351|EZH1_MOUSE Histone-lysine N-methyltransferase EZH1 OS=Mus musculus GN=Ezh1 PE=1 SV=1 164 292 2.0E-17
sp|Q92800|EZH1_HUMAN Histone-lysine N-methyltransferase EZH1 OS=Homo sapiens GN=EZH1 PE=1 SV=2 164 292 2.0E-17
sp|O64827|SUVR5_ARATH Histone-lysine N-methyltransferase SUVR5 OS=Arabidopsis thaliana GN=SUVR5 PE=1 SV=3 153 315 3.0E-17
sp|Q9H5I1|SUV92_HUMAN Histone-lysine N-methyltransferase SUV39H2 OS=Homo sapiens GN=SUV39H2 PE=1 SV=2 153 315 3.0E-17
sp|Q4R3E0|SUV92_MACFA Histone-lysine N-methyltransferase SUV39H2 OS=Macaca fascicularis GN=SUV39H2 PE=2 SV=2 153 315 3.0E-17
sp|Q9EQQ0|SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus GN=Suv39h2 PE=1 SV=1 153 315 5.0E-17
sp|Q6DGD3|SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio GN=suv39h1a PE=2 SV=2 153 294 7.0E-17
sp|Q66J90|SET1B_XENLA Histone-lysine N-methyltransferase SETD1B OS=Xenopus laevis GN=setd1b PE=2 SV=1 154 315 1.0E-16
sp|Q5F3P8|SET1B_CHICK Histone-lysine N-methyltransferase SETD1B OS=Gallus gallus GN=SETD1B PE=2 SV=1 188 315 1.0E-16
sp|Q5RDS6|EZH1_PONAB Histone-lysine N-methyltransferase EZH1 OS=Pongo abelii GN=EZH1 PE=2 SV=1 164 292 1.0E-16
sp|O60016|CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr4 PE=1 SV=2 149 317 1.0E-16
sp|Q32PH7|SUV92_BOVIN Histone-lysine N-methyltransferase SUV39H2 OS=Bos taurus GN=SUV39H2 PE=2 SV=1 153 315 1.0E-16
sp|Q5F3W5|SUV92_CHICK Histone-lysine N-methyltransferase SUV39H2 OS=Gallus gallus GN=SUV39H2 PE=2 SV=1 153 294 2.0E-16
sp|Q1LY77|SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio GN=setd1ba PE=1 SV=2 169 315 2.0E-16
sp|Q9UPS6|SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens GN=SETD1B PE=1 SV=3 188 315 2.0E-16
sp|O54864|SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus GN=Suv39h1 PE=1 SV=1 161 294 2.0E-16
sp|O44757|LIN59_CAEEL Probable histone-lysine N-methyltransferase lin-59 OS=Caenorhabditis elegans GN=lin-59 PE=2 SV=1 138 317 2.0E-16
sp|Q08D57|SET1B_XENTR Histone-lysine N-methyltransferase SETD1B OS=Xenopus tropicalis GN=setd1b PE=2 SV=1 169 315 2.0E-16
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=3 168 315 2.0E-16
sp|Q8CFT2|SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus GN=Setd1b PE=1 SV=2 188 315 3.0E-16
sp|O08550|KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus GN=Kmt2b PE=1 SV=3 178 315 3.0E-16
sp|Q9ZSM8|EZA1_ARATH Histone-lysine N-methyltransferase EZA1 OS=Arabidopsis thaliana GN=EZA1 PE=1 SV=1 163 309 3.0E-16
sp|Q9UMN6|KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens GN=KMT2B PE=1 SV=1 178 315 3.0E-16
sp|Q80UJ9|SETMR_MOUSE Histone-lysine N-methyltransferase SETMAR OS=Mus musculus GN=Setmar PE=2 SV=2 161 315 3.0E-16
sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5 OS=Arabidopsis thaliana GN=ATX5 PE=2 SV=1 168 315 5.0E-16
sp|Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens GN=SETMAR PE=1 SV=2 125 315 5.0E-16
sp|Q95Y12|SET23_CAEEL Probable histone-lysine N-methyltransferase set-23 OS=Caenorhabditis elegans GN=set-23 PE=3 SV=1 120 315 8.0E-16
sp|Q5I0M0|SETMR_RAT Histone-lysine N-methyltransferase SETMAR OS=Rattus norvegicus GN=Setmar PE=2 SV=1 161 315 1.0E-15
sp|Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens GN=KMT2C PE=1 SV=3 169 311 2.0E-15
sp|Q8BRH4|KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus GN=Kmt2c PE=1 SV=2 169 311 2.0E-15
sp|P93831|CLF_ARATH Histone-lysine N-methyltransferase CLF OS=Arabidopsis thaliana GN=CLF PE=1 SV=2 165 309 3.0E-15
sp|Q0VD24|SETMR_BOVIN Histone-lysine N-methyltransferase SETMAR OS=Bos taurus GN=SETMAR PE=2 SV=1 81 315 4.0E-15
sp|Q8S4P5|EZ2_MAIZE Histone-lysine N-methyltransferase EZ2 OS=Zea mays GN=EZ2 PE=2 SV=1 165 309 5.0E-15
sp|Q8S4P4|EZ3_MAIZE Histone-lysine N-methyltransferase EZ3 OS=Zea mays GN=EZ3 PE=2 SV=1 165 309 6.0E-15
sp|O15047|SET1A_HUMAN Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens GN=SETD1A PE=1 SV=3 188 315 6.0E-15
sp|O65312|MEDEA_ARATH Histone-lysine N-methyltransferase MEDEA OS=Arabidopsis thaliana GN=MEA PE=1 SV=1 51 292 9.0E-15
sp|Q5LJZ2|SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster GN=Set1 PE=1 SV=1 169 316 1.0E-14
sp|P0CO26|SET1_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET1 PE=3 SV=1 169 315 1.0E-14
sp|P0CO27|SET1_CRYNB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET1 PE=3 SV=1 169 315 1.0E-14
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 125 315 2.0E-14
sp|Q8S4P6|EZ1_MAIZE Histone-lysine N-methyltransferase EZ1 OS=Zea mays GN=EZ1 PE=2 SV=1 165 313 2.0E-14
sp|P0CB22|ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana GN=ATX2 PE=2 SV=1 182 333 2.0E-14
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=2 168 315 2.0E-13
sp|Q6PDK2|KMT2D_MOUSE Histone-lysine N-methyltransferase 2D OS=Mus musculus GN=Kmt2d PE=1 SV=2 169 311 3.0E-13
sp|O14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D OS=Homo sapiens GN=KMT2D PE=1 SV=2 169 311 3.0E-13
sp|P45975|SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster GN=Su(var)3-9 PE=1 SV=2 187 311 2.0E-12
sp|Q9C5X4|ATX1_ARATH Histone-lysine N-methyltransferase ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2 166 327 3.0E-12
sp|C6KTD2|SET1_PLAF7 Putative histone-lysine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) GN=SET1 PE=2 SV=1 180 313 4.0E-12
sp|Q9SRV2|SUVR3_ARATH Histone-lysine N-methyltransferase SUVR3 OS=Arabidopsis thaliana GN=SUVR3 PE=2 SV=4 153 313 6.0E-12
sp|Q0V9E9|SETD8_XENTR N-lysine methyltransferase SETD8 OS=Xenopus tropicalis GN=setd8 PE=2 SV=1 186 292 7.0E-12
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 160 311 9.0E-12
sp|Q498E6|SET8B_XENLA N-lysine methyltransferase SETD8-B OS=Xenopus laevis GN=setd8-b PE=1 SV=1 186 292 1.0E-11
sp|Q08AY6|SET8A_XENLA N-lysine methyltransferase SETD8-A OS=Xenopus laevis GN=setd8-a PE=2 SV=1 186 292 2.0E-11
sp|O17514|MES2_CAEEL Histone-lysine N-methyltransferase mes-2 OS=Caenorhabditis elegans GN=mes-2 PE=1 SV=2 109 293 2.0E-11
sp|Q294B9|SUV39_DROPS Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila pseudoobscura pseudoobscura GN=Su(var)3-9 PE=3 SV=1 153 311 2.0E-11
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 125 311 4.0E-11
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 125 311 5.0E-11
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 125 313 6.0E-11
sp|Q9NQR1|SETD8_HUMAN N-lysine methyltransferase SETD8 OS=Homo sapiens GN=SETD8 PE=1 SV=3 184 293 2.0E-10
sp|Q2YDW7|SETD8_MOUSE N-lysine methyltransferase SETD8 OS=Mus musculus GN=Setd8 PE=1 SV=1 184 292 2.0E-10
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 160 311 4.0E-10
sp|Q2YDJ8|SETD8_BOVIN N-lysine methyltransferase SETD8 OS=Bos taurus GN=SETD8 PE=2 SV=1 184 292 4.0E-10
sp|Q1L8U8|STB1A_DANRE Histone-lysine N-methyltransferase SETDB1-A OS=Danio rerio GN=setdb1a PE=3 SV=1 240 313 2.0E-09
sp|Q28Z18|SETB1_DROPS Histone-lysine N-methyltransferase eggless OS=Drosophila pseudoobscura pseudoobscura GN=egg PE=3 SV=2 232 311 3.0E-09
sp|Q08BR4|STB1B_DANRE Histone-lysine N-methyltransferase SETDB1-B OS=Danio rerio GN=setdb1b PE=2 SV=2 230 322 4.0E-09
sp|Q8W595|SUVR4_ARATH Histone-lysine N-methyltransferase SUVR4 OS=Arabidopsis thaliana GN=SUVR4 PE=1 SV=2 153 311 4.0E-09
sp|Q6INA9|SETB1_XENLA Histone-lysine N-methyltransferase SETDB1 OS=Xenopus laevis GN=setdb1 PE=2 SV=1 240 313 4.0E-09
sp|Q071E0|SET8A_DANRE N-lysine methyltransferase SETD8-A OS=Danio rerio GN=setd8a PE=2 SV=1 186 292 5.0E-09
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 161 311 6.0E-09
sp|Q32KD2|SETB1_DROME Histone-lysine N-methyltransferase eggless OS=Drosophila melanogaster GN=egg PE=1 SV=1 240 311 8.0E-09
sp|P34544|MET2_CAEEL Histone-lysine N-methyltransferase met-2 OS=Caenorhabditis elegans GN=met-2 PE=3 SV=5 241 313 1.0E-08
sp|O88974|SETB1_MOUSE Histone-lysine N-methyltransferase SETDB1 OS=Mus musculus GN=Setdb1 PE=1 SV=1 240 313 1.0E-08
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 114 313 2.0E-08
sp|Q15047|SETB1_HUMAN Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens GN=SETDB1 PE=1 SV=1 240 313 2.0E-08
sp|Q8X225|DIM5_NEUCR Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dim-5 PE=1 SV=2 153 315 5.0E-08
sp|Q946J2|SUVR1_ARATH Probable inactive histone-lysine N-methyltransferase SUVR1 OS=Arabidopsis thaliana GN=SUVR1 PE=1 SV=2 146 311 6.0E-08
sp|Q6YI93|SETB2_XENLA Histone-lysine N-methyltransferase SETDB2 OS=Xenopus laevis GN=setdb2 PE=2 SV=2 239 311 2.0E-07
sp|Q9VFK6|SETD8_DROME Histone-lysine N-methyltransferase pr-set7 OS=Drosophila melanogaster GN=pr-set7 PE=1 SV=2 186 292 2.0E-07
sp|A4IGY9|SETB2_XENTR Histone-lysine N-methyltransferase SETDB2 OS=Xenopus tropicalis GN=setdb2 PE=2 SV=1 239 311 3.0E-07
sp|O23372|ATXR3_ARATH Histone-lysine N-methyltransferase ATXR3 OS=Arabidopsis thaliana GN=ATXR3 PE=2 SV=2 185 313 1.0E-06
sp|Q297V5|SETD8_DROPS Histone-lysine N-methyltransferase pr-set7 OS=Drosophila pseudoobscura pseudoobscura GN=pr-set7 PE=3 SV=2 186 292 1.0E-06
sp|Q8C267|SETB2_MOUSE Histone-lysine N-methyltransferase SETDB2 OS=Mus musculus GN=Setdb2 PE=2 SV=2 220 311 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005694 chromosome Yes
GO:0005515 protein binding Yes
GO:0018024 histone-lysine N-methyltransferase activity Yes
GO:0034968 histone lysine methylation Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0018022 peptidyl-lysine methylation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0008276 protein methyltransferase activity No
GO:0031323 regulation of cellular metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0006479 protein methylation No
GO:0051252 regulation of RNA metabolic process No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0032259 methylation No
GO:0044260 cellular macromolecule metabolic process No
GO:0008213 protein alkylation No
GO:0016570 histone modification No
GO:0071704 organic substance metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0003824 catalytic activity No
GO:0019538 protein metabolic process No
GO:0016279 protein-lysine N-methyltransferase activity No
GO:0043226 organelle No
GO:0010468 regulation of gene expression No
GO:0005488 binding No
GO:0043228 non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0009889 regulation of biosynthetic process No
GO:0018205 peptidyl-lysine modification No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0043227 membrane-bounded organelle No
GO:0050789 regulation of biological process No
GO:0016278 lysine N-methyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0080090 regulation of primary metabolic process No
GO:0036211 protein modification process No
GO:0044237 cellular metabolic process No
GO:0043414 macromolecule methylation No
GO:0005575 cellular_component No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0042054 histone methyltransferase activity No
GO:0016571 histone methylation No
GO:0044238 primary metabolic process No
GO:0065007 biological regulation No
GO:0006807 nitrogen compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008170 N-methyltransferase activity No
GO:0043412 macromolecule modification No
GO:0019222 regulation of metabolic process No
GO:0008168 methyltransferase activity No
GO:0010556 regulation of macromolecule biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4192 0.7973 0.1956 0.0447 0.0862 0.015 0.0504 0.0186 0.0204 0.0007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1183
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3817
Ophiocordyceps australis map64 (Brazil) OphauB2|6774
Ophiocordyceps camponoti-floridani Ophcf2|03652
Ophiocordyceps camponoti-rufipedis Ophun1|5756
Ophiocordyceps kimflemingae Ophio5|7471
Ophiocordyceps subramaniannii Hirsu2|10323 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10323
MEDDEHAPSGMSRLKLEDAAANGAPPAPDPGASVAPADARHDTFPSPVPSLDGLKSRSDSVETPGPAKPARPVRK
TSQKLPGREPPLFAHLPDVTAQSCETFQVIADCLYGSKHLGSTDNDALDCDCRDEWRDGENCACGDDSDCINRAT
KMECSASGGNCAGGCQNQRFQRKQWATVSVIKTDKKGFGLRADADLHPNDFVYEYIGEVINEPTFRRRMLQYDRE
GIKHFYFMSLSKSEFVDATKKGNLGRFCNHSCSPNCYVDKWVVGDKLRMGVFALRRIRAGEELVFNYNVDRYGAD
PQPCYCGEPNCVGFIGGKTQTERATKLPAATVEALGIDDADGWDTAVAKKPRKKRPDEDDEEYVNSIQPRGLDDD
DARKVMAALMQCKEKWIAVKLLERIQRCDDERAIHCVMRMHAYQILKTTLNTFIHDHNVVLQVLEILDKLPRLTR
NKIQDSNIEAAVEALAASDHQDVASRSRKLLEAWSKLELAYRIRRRKVDPNAPVQHVYEDRRGGQQSREEETAQS
TPKTASPRTIDAPKGPRSSVPQRNNSFYYGGQRPRRQMHAPLPDGWFAAKDGRGKTYFYTKSGNTTWQRPTHPAA
ESIQKGPSKAMQEQLAIQSIIDKVTKEGTPKQPAPAQPREVSETPSKESKKDKWRSLPIDKQMRIYENTVFPPVK
YVLDKFRHKLPKEELKRLGKDIAKKLVASDYKNNRVEDPTAELTDKQVLKIKKFVSDFLNRAVEKYQAHQRRKAS
RSKQSGAGETDGGEAPGGRPQPDGDGGRDSGTDVPAAKTEDLADENMLSDVDVDSPGSQDRKRKREMDLVDSTDA
TPSEGPDAKRVKDDEASPPPPPPPPPETAPEDEMTEAQRAFREQEEALMRENEEAQRLEDEANKSKMMEGAVADE
MRKNIPLAV*
Coding >Hirsu2|10323
ATGGAGGATGACGAGCATGCACCGAGCGGCATGAGCAGGTTGAAGCTCGAGGACGCTGCCGCCAATGGCGCGCCT
CCCGCCCCCGACCCGGGCGCCTCTGTCGCGCCCGCCGACGCGCGCCACGACACGTTTCCCTCCCCCGTGCCCTCG
CTCGACGGCCTCAAGTCTCGCAGCGACAGCGTCGAGACGCCCGGCCCGGCAAAGCCCGCCCGCCCGGTCCGCAAG
ACGTCGCAGAAGCTGCCAGGCCGCGAGCCCCCGTTGTTTGCCCACCTGCCCGACGTCACCGCCCAGTCGTGCGAG
ACCTTTCAGGTCATCGCCGACTGCCTCTACGGCTCCAAGCACCTGGGCTCCACCGACAACGATGCCCTCGACTGC
GACTGCCGCGACGAATGGCGCGACGGCGAGAACTGTGCCTGCGGCGACGACTCCGACTGCATCAACCGCGCCACC
AAGATGGAGTGCAGCGCCAGCGGCGGCAACTGCGCCGGCGGCTGCCAGAACCAGCGCTTCCAGCGCAAGCAGTGG
GCCACCGTCTCCGTCATCAAGACGGACAAGAAGGGCTTCGGCCTCCGCGCCGACGCCGACCTGCACCCCAACGAC
TTCGTCTACGAGTACATCGGCGAGGTCATCAACGAGCCCACCTTCCGCCGCCGCATGCTGCAGTACGACCGCGAG
GGCATCAAGCACTTCTACTTCATGTCCCTCAGCAAGAGCGAGTTCGTCGACGCCACCAAAAAGGGCAACCTCGGC
CGCTTCTGCAACCACTCCTGCAGCCCCAACTGCTACGTTGACAAGTGGGTGGTCGGCGACAAGCTCCGCATGGGC
GTCTTCGCCCTGCGCAGGATCCGCGCCGGCGAGGAGCTCGTCTTCAACTACAACGTCGACCGCTACGGCGCCGAC
CCCCAGCCCTGCTACTGCGGCGAGCCCAACTGCGTCGGCTTCATCGGCGGCAAGACGCAGACGGAGCGCGCCACC
AAGCTGCCCGCCGCCACCGTCGAGGCCCTCGGCATCGACGACGCCGACGGCTGGGACACGGCCGTCGCCAAGAAG
CCGCGCAAGAAGCGGCCCGACGAGGACGACGAGGAGTACGTCAACAGCATCCAGCCCCGCGGCCTCGACGACGAC
GACGCCCGCAAGGTCATGGCCGCCCTCATGCAGTGTAAGGAGAAGTGGATCGCCGTCAAGCTGCTTGAGCGCATC
CAGCGCTGCGACGACGAGCGCGCCATCCACTGCGTCATGCGCATGCACGCCTACCAGATCCTCAAGACGACGCTC
AACACCTTCATCCACGACCACAACGTGGTGCTGCAGGTGCTCGAGATCCTCGACAAGCTGCCCCGTCTGACGAGG
AACAAGATCCAGGACTCCAACATCGAGGCCGCCGTCGAGGCCCTGGCCGCCTCGGACCACCAGGACGTGGCCTCG
AGGTCCAGGAAGCTGCTCGAGGCCTGGAGCAAGCTCGAGCTGGCCTACCGCATCCGCCGCCGCAAGGTCGACCCC
AACGCCCCGGTCCAGCACGTGTACGAGGACCGCCGAGGCGGCCAGCAGTCCCGCGAGGAGGAGACGGCCCAGTCG
ACGCCCAAGACGGCCTCGCCCCGCACCATCGACGCCCCCAAGGGCCCGCGCAGCAGCGTCCCGCAGCGCAACAAC
TCCTTCTACTACGGCGGCCAGCGGCCGCGCCGGCAGATGCACGCGCCCCTGCCCGACGGCTGGTTCGCCGCCAAG
GACGGCAGGGGCAAGACGTACTTCTACACCAAGTCGGGCAACACCACCTGGCAGCGGCCGACCCACCCGGCCGCC
GAGTCGATCCAGAAGGGGCCGTCCAAGGCGATGCAGGAGCAGCTGGCCATCCAGAGCATCATCGACAAGGTCACC
AAGGAGGGCACCCCGAAGCAGCCGGCTCCGGCGCAGCCGAGGGAAGTCTCGGAGACGCCGTCCAAGGAGTCAAAG
AAGGACAAGTGGCGGTCGCTGCCGATTGACAAGCAGATGAGGATATACGAAAACACGGTGTTCCCCCCGGTCAAG
TACGTGCTCGACAAGTTCCGGCACAAGCTGCCCAAGGAGGAGCTCAAGAGGTTGGGCAAAGACATCGCCAAGAAG
CTGGTCGCGTCCGACTACAAGAACAACCGGGTCGAGGACCCCACGGCCGAGCTCACGGACAAGCAAGTGTTGAAG
ATTAAGAAGTTCGTCTCGGACTTTTTGAATCGCGCCGTCGAGAAGTACCAGGCACACCAGAGGCGGAAGGCGTCG
AGGTCGAAGCAGTCCGGCGCCGGGGAGACGGACGGCGGGGAGGCGCCGGGCGGCAGGCCGCAGCCGGACGGAGAC
GGCGGCCGGGACAGCGGGACCGACGTGCCGGCGGCCAAGACGGAGGACCTCGCCGACGAGAACATGCTCAGCGAC
GTCGACGTCGATTCGCCCGGCAGTCAGGACCGCAAGCGGAAACGCGAGATGGACCTGGTGGACTCGACGGACGCG
ACGCCATCGGAAGGCCCCGACGCCAAGAGGGTCAAGGACGACGAGGCGAGCCCGCCGCCGCCGCCGCCGCCGCCT
CCCGAGACGGCGCCGGAGGACGAGATGACGGAGGCGCAGCGAGCGTTCCGGGAGCAGGAGGAAGCGCTGATGCGA
GAGAACGAGGAGGCGCAGAGGCTAGAAGACGAAGCCAACAAGTCCAAGATGATGGAGGGGGCTGTGGCCGACGAG
ATGCGCAAAAACATACCTCTCGCGGTATGA
Transcript >Hirsu2|10323
ATGGAGGATGACGAGCATGCACCGAGCGGCATGAGCAGGTTGAAGCTCGAGGACGCTGCCGCCAATGGCGCGCCT
CCCGCCCCCGACCCGGGCGCCTCTGTCGCGCCCGCCGACGCGCGCCACGACACGTTTCCCTCCCCCGTGCCCTCG
CTCGACGGCCTCAAGTCTCGCAGCGACAGCGTCGAGACGCCCGGCCCGGCAAAGCCCGCCCGCCCGGTCCGCAAG
ACGTCGCAGAAGCTGCCAGGCCGCGAGCCCCCGTTGTTTGCCCACCTGCCCGACGTCACCGCCCAGTCGTGCGAG
ACCTTTCAGGTCATCGCCGACTGCCTCTACGGCTCCAAGCACCTGGGCTCCACCGACAACGATGCCCTCGACTGC
GACTGCCGCGACGAATGGCGCGACGGCGAGAACTGTGCCTGCGGCGACGACTCCGACTGCATCAACCGCGCCACC
AAGATGGAGTGCAGCGCCAGCGGCGGCAACTGCGCCGGCGGCTGCCAGAACCAGCGCTTCCAGCGCAAGCAGTGG
GCCACCGTCTCCGTCATCAAGACGGACAAGAAGGGCTTCGGCCTCCGCGCCGACGCCGACCTGCACCCCAACGAC
TTCGTCTACGAGTACATCGGCGAGGTCATCAACGAGCCCACCTTCCGCCGCCGCATGCTGCAGTACGACCGCGAG
GGCATCAAGCACTTCTACTTCATGTCCCTCAGCAAGAGCGAGTTCGTCGACGCCACCAAAAAGGGCAACCTCGGC
CGCTTCTGCAACCACTCCTGCAGCCCCAACTGCTACGTTGACAAGTGGGTGGTCGGCGACAAGCTCCGCATGGGC
GTCTTCGCCCTGCGCAGGATCCGCGCCGGCGAGGAGCTCGTCTTCAACTACAACGTCGACCGCTACGGCGCCGAC
CCCCAGCCCTGCTACTGCGGCGAGCCCAACTGCGTCGGCTTCATCGGCGGCAAGACGCAGACGGAGCGCGCCACC
AAGCTGCCCGCCGCCACCGTCGAGGCCCTCGGCATCGACGACGCCGACGGCTGGGACACGGCCGTCGCCAAGAAG
CCGCGCAAGAAGCGGCCCGACGAGGACGACGAGGAGTACGTCAACAGCATCCAGCCCCGCGGCCTCGACGACGAC
GACGCCCGCAAGGTCATGGCCGCCCTCATGCAGTGTAAGGAGAAGTGGATCGCCGTCAAGCTGCTTGAGCGCATC
CAGCGCTGCGACGACGAGCGCGCCATCCACTGCGTCATGCGCATGCACGCCTACCAGATCCTCAAGACGACGCTC
AACACCTTCATCCACGACCACAACGTGGTGCTGCAGGTGCTCGAGATCCTCGACAAGCTGCCCCGTCTGACGAGG
AACAAGATCCAGGACTCCAACATCGAGGCCGCCGTCGAGGCCCTGGCCGCCTCGGACCACCAGGACGTGGCCTCG
AGGTCCAGGAAGCTGCTCGAGGCCTGGAGCAAGCTCGAGCTGGCCTACCGCATCCGCCGCCGCAAGGTCGACCCC
AACGCCCCGGTCCAGCACGTGTACGAGGACCGCCGAGGCGGCCAGCAGTCCCGCGAGGAGGAGACGGCCCAGTCG
ACGCCCAAGACGGCCTCGCCCCGCACCATCGACGCCCCCAAGGGCCCGCGCAGCAGCGTCCCGCAGCGCAACAAC
TCCTTCTACTACGGCGGCCAGCGGCCGCGCCGGCAGATGCACGCGCCCCTGCCCGACGGCTGGTTCGCCGCCAAG
GACGGCAGGGGCAAGACGTACTTCTACACCAAGTCGGGCAACACCACCTGGCAGCGGCCGACCCACCCGGCCGCC
GAGTCGATCCAGAAGGGGCCGTCCAAGGCGATGCAGGAGCAGCTGGCCATCCAGAGCATCATCGACAAGGTCACC
AAGGAGGGCACCCCGAAGCAGCCGGCTCCGGCGCAGCCGAGGGAAGTCTCGGAGACGCCGTCCAAGGAGTCAAAG
AAGGACAAGTGGCGGTCGCTGCCGATTGACAAGCAGATGAGGATATACGAAAACACGGTGTTCCCCCCGGTCAAG
TACGTGCTCGACAAGTTCCGGCACAAGCTGCCCAAGGAGGAGCTCAAGAGGTTGGGCAAAGACATCGCCAAGAAG
CTGGTCGCGTCCGACTACAAGAACAACCGGGTCGAGGACCCCACGGCCGAGCTCACGGACAAGCAAGTGTTGAAG
ATTAAGAAGTTCGTCTCGGACTTTTTGAATCGCGCCGTCGAGAAGTACCAGGCACACCAGAGGCGGAAGGCGTCG
AGGTCGAAGCAGTCCGGCGCCGGGGAGACGGACGGCGGGGAGGCGCCGGGCGGCAGGCCGCAGCCGGACGGAGAC
GGCGGCCGGGACAGCGGGACCGACGTGCCGGCGGCCAAGACGGAGGACCTCGCCGACGAGAACATGCTCAGCGAC
GTCGACGTCGATTCGCCCGGCAGTCAGGACCGCAAGCGGAAACGCGAGATGGACCTGGTGGACTCGACGGACGCG
ACGCCATCGGAAGGCCCCGACGCCAAGAGGGTCAAGGACGACGAGGCGAGCCCGCCGCCGCCGCCGCCGCCGCCT
CCCGAGACGGCGCCGGAGGACGAGATGACGGAGGCGCAGCGAGCGTTCCGGGAGCAGGAGGAAGCGCTGATGCGA
GAGAACGAGGAGGCGCAGAGGCTAGAAGACGAAGCCAACAAGTCCAAGATGATGGAGGGGGCTGTGGCCGACGAG
ATGCGCAAAAACATACCTCTCGCGGTATGA
Gene >Hirsu2|10323
ATGGAGGATGACGAGCATGCACCGAGCGGCATGAGCAGGTTGAAGCTCGAGGACGCTGCCGCCAATGGCGCGCCT
CCCGCCCCCGACCCGGGCGCCTCTGTCGCGCCCGCCGACGCGCGCCACGACACGTTTCCCTCCCCCGTGCCCTCG
CTCGACGGCCTCAAGTCTCGCAGCGACAGCGTCGAGACGCCCGGCCCGGCAAAGCCCGCCCGCCCGGTCCGCAAG
ACGTCGCAGAAGCTGCCAGGCCGCGAGCCCCCGTTGTTTGCCCACCTGCCCGACGTCACCGCCCAGTCGTGCGAG
ACCTTTCAGGTCATCGCCGACTGCCTCTACGGCTCCAAGCACCTGGGCTCCACCGACAACGATGCCCTCGACTGC
GACTGCCGCGACGAATGGCGTACGCGTCTCCCCTCCCCCCCGTCCCGTCCCATCCGCTGGCCGTCTGCCCTGCCC
GGCAAGCCGCTGACCTGACCCCCTTCCGTCCCGCAGGCGACGGCGAGAACTGTGCCTGCGGCGACGACTCCGACT
GCATCAACCGCGCCACCAAGATGGAGTGCAGCGCCAGCGGCGGCAACTGCGCCGGCGGCTGCCAGAACCAGCGCT
TCCAGCGCAAGCAGTGGGCCACCGTCTCCGTCATCAAGACGGACAAGAAGGGCTTCGGCCTCCGCGCCGACGCCG
ACCTGCACCCCAACGACTTCGTCTACGAGTACATCGGCGAGGTCATCAACGAGCCCACCTTCCGCCGCCGCATGC
TGCAGTACGACCGCGAGGGCATCAAGCACTTCTACTTCATGTCCCTCAGCAAGAGCGAGTTCGTCGACGCCACCA
AAAAGGGCAACCTCGGCCGCTTCTGCAACCACTCCTGCAGCCCCAACTGCTACGTTGACAAGTGGGTGGTCGGCG
ACAAGCTCCGCATGGGCGTCTTCGCCCTGCGCAGGATCCGCGCCGGCGAGGAGCTCGTCTTCAACTACAACGTCG
ACCGCTACGGCGCCGACCCCCAGCCCTGCTACTGCGGCGAGCCCAACTGCGTCGGCTTCATCGGCGGCAAGACGC
AGACGGAGCGCGCCACCAAGCTGCCCGCCGCCACCGTCGAGGCCCTCGGCATCGACGACGCCGACGGCTGGGACA
CGGCCGTCGCCAAGAAGCCGCGCAAGAAGCGGCCCGACGAGGACGACGAGGAGTACGTCAACAGCATCCAGCCCC
GCGGCCTCGACGACGACGACGCCCGCAAGGTCATGGCCGCCCTCATGCAGTGTAAGGAGAAGTGGATCGCCGTCA
AGCTGCTTGAGCGCATCCAGCGCTGCGACGACGAGCGCGCCATCCACTGCGTCATGCGCATGCACGCCTACCAGA
TCCTCAAGACGACGCTCAACACCTTCATCCACGACCACAACGTGGTGCTGCAGGTGCTCGAGATCCTCGACAAGC
TGCCCCGTCTGACGAGGAACAAGATCCAGGACTCCAACATCGAGGCCGCCGTCGAGGCCCTGGCCGCCTCGGACC
ACCAGGACGTGGCCTCGAGGTCCAGGAAGCTGCTCGAGGCCTGGAGCAAGCTCGAGCTGGCCTACCGCATCCGCC
GCCGCAAGGTCGACCCCAACGCCCCGGTCCAGCACGTGTACGAGGACCGCCGAGGCGGCCAGCAGTCCCGCGAGG
AGGAGACGGCCCAGTCGACGCCCAAGACGGCCTCGCCCCGCACCATCGACGCCCCCAAGGGCCCGCGCAGCAGCG
TCCCGCAGCGCAACAACTCCTTCTACTACGGCGGCCAGCGGCCGCGCCGGCAGATGCACGCGCCCCTGCCCGACG
GCTGGTTCGCCGCCAAGGACGGCAGGGGCAAGACGTACTTCTACACCAAGTCGGGCAACACCACCTGGCAGCGGC
CGACCCACCCGGCCGCCGAGTCGATCCAGAAGGGGCCGTCCAAGGCGATGCAGGAGCAGCTGGCCATCCAGAGCA
TCATCGACAAGGTCACCAAGGAGGGCACCCCGAAGCAGCCGGCTCCGGCGCAGCCGAGGGAAGTCTCGGAGACGC
CGTCCAAGGAGTCAAAGAAGGACAAGTGGCGGTCGCTGCCGATTGACAAGCAGATGAGGATATACGAAAACACGG
TAAGCATGCTGCACCCGTCGAGCCCCCTCCCCCGCTGACGGGAAAAAAAAACAACACCAGGTGTTCCCCCCGGTC
AAGTACGTGCTCGACAAGTTCCGGCACAAGCTGCCCAAGGAGGAGCTCAAGAGGTTGGGCAAAGACATCGCCAAG
AAGCTGGTCGCGTCCGACTACAAGAACAACCGGGTCGAGGACCCCACGGCCGAGCTCACGGACAAGCAAGTGTTG
AAGATTAAGAAGTTCGTCTCGGACTTTTTGAATCGCGCCGTCGAGAAGTACCAGGCACACCAGAGGCGGAAGGCG
TCGAGGTCGAAGCAGTCCGGCGCCGGGGAGACGGACGGCGGGGAGGCGCCGGGCGGCAGGCCGCAGCCGGACGGA
GACGGCGGCCGGGACAGCGGGACCGACGTGCCGGCGGCCAAGACGGAGGACCTCGCCGACGAGAACATGCTCAGC
GACGTCGACGTCGATTCGCCCGGCAGTCAGGACCGCAAGCGGAAACGCGAGATGGACCTGGTGGACTCGACGGAC
GCGACGCCATCGGAAGGCCCCGACGCCAAGAGGGTCAAGGACGACGAGGCGAGCCCGCCGCCGCCGCCGCCGCCG
CCTCCCGAGACGGCGCCGGAGGACGAGATGACGGAGGCGCAGCGAGCGTTCCGGGAGCAGGAGGAAGCGCTGATG
CGAGAGAACGAGGAGGCGCAGAGGCTAGAAGACGAAGCCAACAAGTCCAAGATGATGGAGGGGGCTGTGGCCGAC
GAGATGCGCAAAAACATACCTCTCGCGGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail