Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10315
Gene name
LocationContig_820:62..1069
Strand+
Gene length (bp)1007
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 1.9E-45 14 154
PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain 4.2E-31 160 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93937|PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrABCN PE=3 SV=2 1 314 2.0E-151
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 3 313 6.0E-136
sp|Q09794|PYR1_SCHPO Protein ura1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura1 PE=1 SV=1 1 313 8.0E-132
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 13 313 1.0E-107
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 13 312 8.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93937|PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrABCN PE=3 SV=2 1 314 2.0E-151
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 3 313 6.0E-136
sp|Q09794|PYR1_SCHPO Protein ura1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura1 PE=1 SV=1 1 313 8.0E-132
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 13 313 1.0E-107
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 13 312 8.0E-102
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 13 312 1.0E-101
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 13 312 2.0E-101
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 3 312 5.0E-100
sp|Q9HKM2|PYRB_THEAC Aspartate carbamoyltransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pyrB PE=3 SV=1 9 312 1.0E-94
sp|O58451|PYRB_PYRHO Aspartate carbamoyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pyrB PE=3 SV=1 10 312 2.0E-94
sp|Q97B29|PYRB_THEVO Aspartate carbamoyltransferase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pyrB PE=3 SV=1 9 312 5.0E-94
sp|Q8U373|PYRB_PYRFU Aspartate carbamoyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pyrB PE=3 SV=1 10 312 4.0E-93
sp|O30130|PYRB_ARCFU Aspartate carbamoyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pyrB PE=3 SV=1 13 312 1.0E-92
sp|P77918|PYRB_PYRAB Aspartate carbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pyrB PE=1 SV=1 10 312 2.0E-91
sp|Q0STN4|PYRB_CLOPS Aspartate carbamoyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=pyrB PE=3 SV=1 10 312 9.0E-91
sp|B6YXW4|PYRB_THEON Aspartate carbamoyltransferase OS=Thermococcus onnurineus (strain NA1) GN=pyrB PE=3 SV=1 10 312 2.0E-90
sp|C5A2H1|PYRB_THEGJ Aspartate carbamoyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pyrB PE=3 SV=1 10 312 3.0E-90
sp|Q6L0F2|PYRB_PICTO Aspartate carbamoyltransferase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pyrB PE=3 SV=1 9 312 4.0E-90
sp|Q0TRA8|PYRB_CLOP1 Aspartate carbamoyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pyrB PE=3 SV=1 10 312 4.0E-90
sp|Q18J05|PYRB_HALWD Aspartate carbamoyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pyrB PE=3 SV=1 10 308 8.0E-90
sp|Q5JHM9|PYRB_THEKO Aspartate carbamoyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pyrB PE=3 SV=1 10 306 9.0E-90
sp|Q8F812|PYRB_LEPIN Aspartate carbamoyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pyrB PE=3 SV=2 10 312 2.0E-89
sp|Q8XL59|PYRB_CLOPE Aspartate carbamoyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=pyrB PE=3 SV=1 10 312 4.0E-89
sp|Q72NJ5|PYRB_LEPIC Aspartate carbamoyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pyrB PE=3 SV=2 10 312 1.0E-88
sp|Q04YW0|PYRB_LEPBL Aspartate carbamoyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pyrB PE=3 SV=1 10 312 3.0E-88
sp|Q04UL7|PYRB_LEPBJ Aspartate carbamoyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pyrB PE=3 SV=1 10 312 3.0E-88
sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 13 312 2.0E-87
sp|C3KU87|PYRB_CLOB6 Aspartate carbamoyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=pyrB PE=3 SV=1 10 312 4.0E-87
sp|B0SMK5|PYRB_LEPBP Aspartate carbamoyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=pyrB PE=3 SV=1 9 312 4.0E-87
sp|B0SEH6|PYRB_LEPBA Aspartate carbamoyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=pyrB PE=3 SV=1 9 312 4.0E-87
sp|B2TNG3|PYRB_CLOBB Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pyrB PE=3 SV=1 10 309 7.0E-87
sp|B2UW93|PYRB_CLOBA Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pyrB PE=3 SV=1 10 309 9.0E-87
sp|A7GII2|PYRB_CLOBL Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=pyrB PE=3 SV=1 10 312 2.0E-86
sp|C1FLB6|PYRB_CLOBJ Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=pyrB PE=3 SV=1 10 312 2.0E-86
sp|A5I6X1|PYRB_CLOBH Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pyrB PE=3 SV=1 10 312 2.0E-86
sp|A7FYJ2|PYRB_CLOB1 Aspartate carbamoyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=pyrB PE=3 SV=1 10 312 2.0E-86
sp|Q8TVB2|PYRB_METKA Aspartate carbamoyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pyrB PE=3 SV=1 8 313 3.0E-86
sp|B1L1E7|PYRB_CLOBM Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pyrB PE=3 SV=1 10 312 7.0E-86
sp|A0B8L1|PYRB_METTP Aspartate carbamoyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pyrB PE=3 SV=1 9 312 2.0E-85
sp|B1INE7|PYRB_CLOBK Aspartate carbamoyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=pyrB PE=3 SV=1 10 312 4.0E-85
sp|Q3IPU8|PYRB_NATPD Aspartate carbamoyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pyrB PE=3 SV=1 10 308 4.0E-85
sp|Q7P145|PYRB_CHRVO Aspartate carbamoyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pyrB PE=3 SV=1 12 312 1.0E-84
sp|Q9HHN4|PYRB_HALSA Aspartate carbamoyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pyrB PE=3 SV=2 13 313 1.0E-84
sp|Q97FS3|PYRB_CLOAB Aspartate carbamoyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyrB PE=3 SV=1 51 312 7.0E-84
sp|P49077|PYRB_ARATH Aspartate carbamoyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PYRB PE=2 SV=2 10 312 1.0E-83
sp|A6LS54|PYRB_CLOB8 Aspartate carbamoyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pyrB PE=3 SV=1 13 315 3.0E-83
sp|Q0W5I2|PYRB_METAR Aspartate carbamoyltransferase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pyrB PE=3 SV=1 10 312 4.0E-83
sp|Q46DA6|PYRB_METBF Aspartate carbamoyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pyrB PE=3 SV=1 9 310 8.0E-83
sp|Q43087|PYRB2_PEA Aspartate carbamoyltransferase 2, chloroplastic OS=Pisum sativum GN=PYRB2 PE=2 SV=1 1 312 2.0E-81
sp|A6UQU0|PYRB_METVS Aspartate carbamoyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pyrB PE=3 SV=1 13 311 3.0E-81
sp|A4SHP8|PYRB_AERS4 Aspartate carbamoyltransferase OS=Aeromonas salmonicida (strain A449) GN=pyrB PE=3 SV=1 12 312 3.0E-81
sp|Q8THL2|PYRB_METAC Aspartate carbamoyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pyrB PE=3 SV=1 10 312 4.0E-81
sp|Q12ZP0|PYRB_METBU Aspartate carbamoyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pyrB PE=3 SV=1 9 315 6.0E-81
sp|A1RTF7|PYRB_PYRIL Aspartate carbamoyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=pyrB PE=3 SV=1 9 314 9.0E-81
sp|Q9LD61|PYRB_ORYSJ Aspartate carbamoyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=PYRB PE=2 SV=1 15 312 9.0E-81
sp|A6VHS2|PYRB_METM7 Aspartate carbamoyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pyrB PE=3 SV=1 13 312 1.0E-80
sp|C4LBX2|PYRB_TOLAT Aspartate carbamoyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pyrB PE=3 SV=1 12 312 2.0E-80
sp|O27464|PYRB_METTH Aspartate carbamoyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pyrB PE=3 SV=1 13 313 2.0E-80
sp|A4G0R3|PYRB_METM5 Aspartate carbamoyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pyrB PE=3 SV=1 13 312 2.0E-80
sp|A0KQG0|PYRB_AERHH Aspartate carbamoyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pyrB PE=3 SV=2 12 312 2.0E-80
sp|A1KRE1|PYRB_NEIMF Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pyrB PE=3 SV=1 7 312 4.0E-80
sp|Q43086|PYRB1_PEA Aspartate carbamoyltransferase 1, chloroplastic OS=Pisum sativum GN=PYRB1 PE=2 SV=1 3 312 4.0E-80
sp|A5N2L8|PYRB_CLOK5 Aspartate carbamoyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pyrB PE=3 SV=1 10 308 5.0E-80
sp|B9E695|PYRB_CLOK1 Aspartate carbamoyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=pyrB PE=3 SV=1 10 308 5.0E-80
sp|Q8PXK5|PYRB_METMA Aspartate carbamoyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pyrB PE=3 SV=1 10 312 5.0E-80
sp|P65616|PYRB_NEIMB Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pyrB PE=3 SV=1 7 312 6.0E-80
sp|P65615|PYRB_NEIMA Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pyrB PE=3 SV=1 7 312 6.0E-80
sp|Q8ZYH7|PYRB_PYRAE Aspartate carbamoyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pyrB PE=3 SV=1 9 313 6.0E-80
sp|Q18CS8|PYRB_PEPD6 Aspartate carbamoyltransferase OS=Peptoclostridium difficile (strain 630) GN=pyrB PE=3 SV=1 48 308 8.0E-80
sp|A3CW66|PYRB_METMJ Aspartate carbamoyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pyrB PE=3 SV=1 14 312 8.0E-80
sp|B0TSQ4|PYRB1_SHEHH Aspartate carbamoyltransferase 1 OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrB1 PE=3 SV=1 12 313 9.0E-80
sp|A0Q2N5|PYRB_CLONN Aspartate carbamoyltransferase OS=Clostridium novyi (strain NT) GN=pyrB PE=3 SV=1 51 313 2.0E-79
sp|A9A906|PYRB_METM6 Aspartate carbamoyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pyrB PE=3 SV=1 13 312 2.0E-79
sp|Q58976|PYRB_METJA Aspartate carbamoyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pyrB PE=1 SV=1 13 308 2.0E-79
sp|Q5F5P0|PYRB_NEIG1 Aspartate carbamoyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pyrB PE=3 SV=1 7 312 2.0E-79
sp|B4RPW7|PYRB_NEIG2 Aspartate carbamoyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pyrB PE=3 SV=1 7 312 3.0E-79
sp|Q6LWQ0|PYRB_METMP Aspartate carbamoyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=pyrB PE=3 SV=1 13 312 4.0E-79
sp|A3MY52|PYRB_PYRCJ Aspartate carbamoyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pyrB PE=3 SV=1 15 314 4.0E-79
sp|A6LA97|PYRB_PARD8 Aspartate carbamoyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=pyrB PE=3 SV=1 11 312 7.0E-79
sp|Q43064|PYRB3_PEA Aspartate carbamoyltransferase 3, chloroplastic OS=Pisum sativum GN=PYRB3 PE=2 SV=1 1 312 1.0E-78
sp|P96174|PYRB_VIBS2 Aspartate carbamoyltransferase catalytic chain OS=Vibrio sp. (strain 2693) GN=pyrB PE=3 SV=3 12 312 2.0E-78
sp|A8MAC7|PYRB_CALMQ Aspartate carbamoyltransferase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=pyrB PE=3 SV=1 9 312 4.0E-78
sp|A9M469|PYRB_NEIM0 Aspartate carbamoyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pyrB PE=3 SV=1 7 312 5.0E-78
sp|Q2NIC0|PYRB_METST Aspartate carbamoyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pyrB PE=3 SV=1 10 312 6.0E-78
sp|A6UWP3|PYRB_META3 Aspartate carbamoyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pyrB PE=3 SV=1 13 311 8.0E-78
sp|Q5V2T3|PYRB_HALMA Aspartate carbamoyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pyrB PE=3 SV=1 10 312 1.0E-77
sp|Q87LF8|PYRB_VIBPA Aspartate carbamoyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pyrB PE=3 SV=1 12 312 3.0E-77
sp|B9LND9|PYRB_HALLT Aspartate carbamoyltransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pyrB PE=3 SV=1 10 312 4.0E-77
sp|A6TVR2|PYRB_ALKMQ Aspartate carbamoyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=pyrB PE=3 SV=1 10 310 8.0E-77
sp|B1Y9R0|PYRB_PYRNV Aspartate carbamoyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pyrB PE=3 SV=1 9 312 1.0E-76
sp|B6EMS5|PYRB_ALISL Aspartate carbamoyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=pyrB PE=3 SV=1 12 312 1.0E-76
sp|A8MIU1|PYRB_ALKOO Aspartate carbamoyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=pyrB PE=3 SV=1 10 313 1.0E-76
sp|Q8DCF6|PYRB_VIBVU Aspartate carbamoyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=pyrB PE=3 SV=1 8 312 2.0E-76
sp|Q9KP66|PYRB_VIBCH Aspartate carbamoyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pyrB PE=3 SV=2 12 312 2.0E-76
sp|A1A1F7|PYRB_BIFAA Aspartate carbamoyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pyrB PE=3 SV=2 41 307 2.0E-76
sp|A5F5C9|PYRB_VIBC3 Aspartate carbamoyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pyrB PE=3 SV=2 12 312 3.0E-76
sp|B8GF03|PYRB_METPE Aspartate carbamoyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pyrB PE=3 SV=1 16 313 3.0E-76
sp|A2BJ24|PYRB_HYPBU Aspartate carbamoyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pyrB PE=3 SV=1 8 311 4.0E-76
sp|B0TPF3|PYRB3_SHEHH Aspartate carbamoyltransferase 3 OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrB3 PE=3 SV=1 12 312 5.0E-76
sp|A1SZR6|PYRB_PSYIN Aspartate carbamoyltransferase OS=Psychromonas ingrahamii (strain 37) GN=pyrB PE=3 SV=1 12 304 5.0E-76
sp|A9KNJ3|PYRB_CLOPH Aspartate carbamoyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=pyrB PE=3 SV=1 13 312 5.0E-76
sp|A6L5J9|PYRB_BACV8 Aspartate carbamoyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=pyrB PE=3 SV=1 15 312 6.0E-76
sp|A0RXJ5|PYRB_CENSY Aspartate carbamoyltransferase OS=Cenarchaeum symbiosum (strain A) GN=pyrB PE=3 SV=1 51 312 6.0E-76
sp|Q8A9S3|PYRB_BACTN Aspartate carbamoyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pyrB PE=3 SV=1 15 312 6.0E-76
sp|A9A2Q5|PYRB_NITMS Aspartate carbamoyltransferase OS=Nitrosopumilus maritimus (strain SCM1) GN=pyrB PE=3 SV=1 10 312 1.0E-75
sp|A5UMP0|PYRB_METS3 Aspartate carbamoyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pyrB PE=3 SV=1 10 312 1.0E-75
sp|B7GRV4|PYRB_BIFLS Aspartate carbamoyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=pyrB PE=3 SV=1 51 312 1.0E-75
sp|Q6LUX0|PYRB_PHOPR Aspartate carbamoyltransferase OS=Photobacterium profundum GN=pyrB PE=3 SV=1 8 312 2.0E-75
sp|Q8G655|PYRB_BIFLO Aspartate carbamoyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=pyrB PE=3 SV=2 51 312 2.0E-75
sp|B3DS61|PYRB_BIFLD Aspartate carbamoyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=pyrB PE=3 SV=1 51 312 2.0E-75
sp|Q7MHF1|PYRB_VIBVY Aspartate carbamoyltransferase OS=Vibrio vulnificus (strain YJ016) GN=pyrB PE=3 SV=1 8 312 2.0E-75
sp|Q7MX58|PYRB_PORGI Aspartate carbamoyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pyrB PE=3 SV=1 13 312 3.0E-75
sp|A7MSE0|PYRB_VIBCB Aspartate carbamoyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pyrB PE=3 SV=2 12 312 3.0E-75
sp|A4WGX8|PYRB_PYRAR Aspartate carbamoyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pyrB PE=3 SV=1 9 313 6.0E-75
sp|Q5E7U5|PYRB_VIBF1 Aspartate carbamoyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pyrB PE=3 SV=1 12 312 7.0E-75
sp|B5F9P9|PYRB_VIBFM Aspartate carbamoyltransferase OS=Vibrio fischeri (strain MJ11) GN=pyrB PE=3 SV=1 12 312 8.0E-75
sp|B7LCV3|PYRB_ECO55 Aspartate carbamoyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=pyrB PE=3 SV=1 12 312 8.0E-75
sp|A1RZC5|PYRB_THEPD Aspartate carbamoyltransferase OS=Thermofilum pendens (strain Hrk 5) GN=pyrB PE=3 SV=1 5 312 1.0E-74
sp|C1D9A7|PYRB_LARHH Aspartate carbamoyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=pyrB PE=3 SV=1 12 312 1.0E-74
sp|Q3YUA6|PYRB_SHISS Aspartate carbamoyltransferase OS=Shigella sonnei (strain Ss046) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|P0A789|PYRB_SHIFL Aspartate carbamoyltransferase catalytic chain OS=Shigella flexneri GN=pyrB PE=3 SV=2 12 312 2.0E-74
sp|Q0SXI6|PYRB_SHIF8 Aspartate carbamoyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|Q328U0|PYRB_SHIDS Aspartate carbamoyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|Q31TI1|PYRB_SHIBS Aspartate carbamoyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B2TYZ8|PYRB_SHIB3 Aspartate carbamoyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|Q1R309|PYRB_ECOUT Aspartate carbamoyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B1LRD2|PYRB_ECOSM Aspartate carbamoyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B6I2F9|PYRB_ECOSE Aspartate carbamoyltransferase OS=Escherichia coli (strain SE11) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B7NGH8|PYRB_ECOLU Aspartate carbamoyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|P0A786|PYRB_ECOLI Aspartate carbamoyltransferase catalytic chain OS=Escherichia coli (strain K12) GN=pyrB PE=1 SV=2 12 312 2.0E-74
sp|B1ISW0|PYRB_ECOLC Aspartate carbamoyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|P0A787|PYRB_ECOL6 Aspartate carbamoyltransferase catalytic chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pyrB PE=3 SV=2 12 312 2.0E-74
sp|Q0T9E3|PYRB_ECOL5 Aspartate carbamoyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|A1AJF0|PYRB_ECOK1 Aspartate carbamoyltransferase OS=Escherichia coli O1:K1 / APEC GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|A8A803|PYRB_ECOHS Aspartate carbamoyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B1XEM6|PYRB_ECODH Aspartate carbamoyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|C4ZRB8|PYRB_ECOBW Aspartate carbamoyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B7M9K5|PYRB_ECO8A Aspartate carbamoyltransferase OS=Escherichia coli O8 (strain IAI1) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B7MTC3|PYRB_ECO81 Aspartate carbamoyltransferase OS=Escherichia coli O81 (strain ED1a) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B7NUG1|PYRB_ECO7I Aspartate carbamoyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B5Z3K3|PYRB_ECO5E Aspartate carbamoyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|P0A788|PYRB_ECO57 Aspartate carbamoyltransferase catalytic chain OS=Escherichia coli O157:H7 GN=pyrB PE=3 SV=2 12 312 2.0E-74
sp|B7MLQ3|PYRB_ECO45 Aspartate carbamoyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|B7UQQ5|PYRB_ECO27 Aspartate carbamoyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|A7ZVC7|PYRB_ECO24 Aspartate carbamoyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pyrB PE=3 SV=1 12 312 2.0E-74
sp|Q64U74|PYRB_BACFR Aspartate carbamoyltransferase OS=Bacteroides fragilis (strain YCH46) GN=pyrB PE=3 SV=1 15 312 3.0E-74
sp|Q5LD54|PYRB_BACFN Aspartate carbamoyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pyrB PE=3 SV=1 15 312 3.0E-74
sp|Q2FN12|PYRB_METHJ Aspartate carbamoyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pyrB PE=3 SV=1 13 312 9.0E-74
sp|B6YRC6|PYRB_AZOPC Aspartate carbamoyltransferase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=pyrB PE=3 SV=1 11 312 1.0E-73
sp|B0TST3|PYRB2_SHEHH Aspartate carbamoyltransferase 2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrB2 PE=3 SV=1 12 313 1.0E-73
sp|B7LMR8|PYRB_ESCF3 Aspartate carbamoyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pyrB PE=3 SV=1 12 312 3.0E-73
sp|A6THH4|PYRB_KLEP7 Aspartate carbamoyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pyrB PE=3 SV=1 12 312 1.0E-72
sp|B1L385|PYRB_KORCO Aspartate carbamoyltransferase OS=Korarchaeum cryptofilum (strain OPF8) GN=pyrB PE=3 SV=1 9 312 1.0E-72
sp|A8AMC8|PYRB_CITK8 Aspartate carbamoyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pyrB PE=3 SV=1 12 312 1.0E-72
sp|B5Y2U6|PYRB_KLEP3 Aspartate carbamoyltransferase OS=Klebsiella pneumoniae (strain 342) GN=pyrB PE=3 SV=1 12 312 2.0E-72
sp|A7MQG0|PYRB_CROS8 Aspartate carbamoyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pyrB PE=3 SV=1 12 312 2.0E-72
sp|Q21I34|PYRB_SACD2 Aspartate carbamoyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pyrB PE=3 SV=1 10 312 2.0E-72
sp|B0S198|PYRB_FINM2 Aspartate carbamoyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=pyrB PE=3 SV=1 10 308 3.0E-72
sp|A4W605|PYRB_ENT38 Aspartate carbamoyltransferase OS=Enterobacter sp. (strain 638) GN=pyrB PE=3 SV=1 12 312 4.0E-72
sp|A9MEW2|PYRB_SALAR Aspartate carbamoyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pyrB PE=3 SV=1 12 312 8.0E-72
sp|C0QVX1|PYRB_BRAHW Aspartate carbamoyltransferase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=pyrB PE=3 SV=1 13 310 1.0E-71
sp|C0Q7B8|PYRB_SALPC Aspartate carbamoyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=pyrB PE=3 SV=1 12 312 1.0E-71
sp|P0A1Z4|PYRB_SALTY Aspartate carbamoyltransferase catalytic chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pyrB PE=3 SV=2 12 312 2.0E-71
sp|P0A1Z5|PYRB_SALTI Aspartate carbamoyltransferase catalytic chain OS=Salmonella typhi GN=pyrB PE=3 SV=2 12 312 2.0E-71
sp|B4TT83|PYRB_SALSV Aspartate carbamoyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|B5BKQ9|PYRB_SALPK Aspartate carbamoyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|A9N659|PYRB_SALPB Aspartate carbamoyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pyrB PE=3 SV=2 12 312 2.0E-71
sp|Q5PJB2|PYRB_SALPA Aspartate carbamoyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|B4T3K6|PYRB_SALNS Aspartate carbamoyltransferase OS=Salmonella newport (strain SL254) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|B4TG41|PYRB_SALHS Aspartate carbamoyltransferase OS=Salmonella heidelberg (strain SL476) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|B5R9J9|PYRB_SALG2 Aspartate carbamoyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|B5R1I6|PYRB_SALEP Aspartate carbamoyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|Q57GE1|PYRB_SALCH Aspartate carbamoyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|B5F446|PYRB_SALA4 Aspartate carbamoyltransferase OS=Salmonella agona (strain SL483) GN=pyrB PE=3 SV=1 12 312 2.0E-71
sp|B4F2M2|PYRB_PROMH Aspartate carbamoyltransferase OS=Proteus mirabilis (strain HI4320) GN=pyrB PE=3 SV=1 13 312 3.0E-71
sp|A3DM48|PYRB_STAMF Aspartate carbamoyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pyrB PE=3 SV=1 10 313 7.0E-71
sp|B5FSF3|PYRB_SALDC Aspartate carbamoyltransferase OS=Salmonella dublin (strain CT_02021853) GN=pyrB PE=3 SV=1 12 312 1.0E-70
sp|Q6DA73|PYRB_PECAS Aspartate carbamoyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pyrB PE=3 SV=1 12 312 7.0E-70
sp|A8G961|PYRB_SERP5 Aspartate carbamoyltransferase OS=Serratia proteamaculans (strain 568) GN=pyrB PE=3 SV=1 13 312 9.0E-70
sp|B3PKF2|PYRB_CELJU Aspartate carbamoyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=pyrB PE=3 SV=1 10 312 3.0E-69
sp|C6DJL3|PYRB_PECCP Aspartate carbamoyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pyrB PE=3 SV=1 12 312 5.0E-69
sp|A2SRK7|PYRB_METLZ Aspartate carbamoyltransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pyrB PE=3 SV=1 11 312 6.0E-69
sp|Q1LTK6|PYRB_BAUCH Aspartate carbamoyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pyrB PE=3 SV=2 12 312 1.0E-68
sp|Q7MZ16|PYRB_PHOLL Aspartate carbamoyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pyrB PE=3 SV=1 12 312 1.0E-68
sp|Q9YBD4|PYRB_AERPE Aspartate carbamoyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pyrB PE=3 SV=2 8 312 1.0E-68
sp|A4YI52|PYRB_METS5 Aspartate carbamoyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pyrB PE=3 SV=1 13 313 6.0E-68
sp|A1JRD5|PYRB_YERE8 Aspartate carbamoyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pyrB PE=3 SV=1 13 312 7.0E-68
sp|Q55338|PYRB_SULAC Aspartate carbamoyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pyrB PE=1 SV=1 13 311 8.0E-68
sp|Q8K9H9|PYRB_BUCAP Aspartate carbamoyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pyrB PE=3 SV=1 12 312 1.0E-67
sp|Q970X2|PYRB_SULTO Aspartate carbamoyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pyrB PE=3 SV=1 13 308 4.0E-67
sp|Q2NR35|PYRB_SODGM Aspartate carbamoyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pyrB PE=3 SV=1 12 312 2.0E-66
sp|A5EVP6|PYRB_DICNV Aspartate carbamoyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=pyrB PE=3 SV=1 14 312 2.0E-66
sp|C4K7I6|PYRB_HAMD5 Aspartate carbamoyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pyrB PE=3 SV=1 12 314 3.0E-66
sp|B1JKJ8|PYRB_YERPY Aspartate carbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pyrB PE=3 SV=1 13 312 5.0E-66
sp|A7FDV1|PYRB_YERP3 Aspartate carbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pyrB PE=3 SV=1 13 312 5.0E-66
sp|P19910|PYRB_SERMA Aspartate carbamoyltransferase catalytic chain OS=Serratia marcescens GN=pyrB PE=3 SV=2 13 315 1.0E-65
sp|B8D7Q6|PYRB_BUCAT Aspartate carbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pyrB PE=3 SV=1 12 312 3.0E-65
sp|B8D9F4|PYRB_BUCA5 Aspartate carbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pyrB PE=3 SV=1 12 312 3.0E-65
sp|Q665I6|PYRB_YERPS Aspartate carbamoyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pyrB PE=3 SV=1 13 312 3.0E-65
sp|B2K421|PYRB_YERPB Aspartate carbamoyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pyrB PE=3 SV=1 13 312 3.0E-65
sp|A4THG6|PYRB_YERPP Aspartate carbamoyltransferase OS=Yersinia pestis (strain Pestoides F) GN=pyrB PE=3 SV=1 13 312 3.0E-65
sp|Q1CDY3|PYRB_YERPN Aspartate carbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pyrB PE=3 SV=1 13 312 3.0E-65
sp|A9R1U2|PYRB_YERPG Aspartate carbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pyrB PE=3 SV=1 13 312 3.0E-65
sp|Q8ZB39|PYRB_YERPE Aspartate carbamoyltransferase OS=Yersinia pestis GN=pyrB PE=1 SV=1 13 312 3.0E-65
sp|Q1C1J5|PYRB_YERPA Aspartate carbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pyrB PE=3 SV=1 13 312 3.0E-65
sp|P57450|PYRB_BUCAI Aspartate carbamoyltransferase catalytic chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pyrB PE=3 SV=1 12 312 5.0E-65
sp|Q8D293|PYRB_WIGBR Aspartate carbamoyltransferase OS=Wigglesworthia glossinidia brevipalpis GN=pyrB PE=3 SV=1 13 312 7.0E-64
sp|Q9UX08|PYRB_SULSO Aspartate carbamoyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pyrB PE=3 SV=1 13 312 1.0E-61
sp|C3NEP5|PYRB_SULIY Aspartate carbamoyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pyrB PE=3 SV=1 13 312 1.0E-61
sp|C3NGZ9|PYRB_SULIN Aspartate carbamoyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pyrB PE=3 SV=1 13 312 1.0E-61
sp|C3MQG7|PYRB_SULIL Aspartate carbamoyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pyrB PE=3 SV=1 13 312 1.0E-61
sp|C4KHQ2|PYRB_SULIK Aspartate carbamoyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pyrB PE=3 SV=1 13 312 2.0E-61
sp|C3MW45|PYRB_SULIM Aspartate carbamoyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pyrB PE=3 SV=1 13 312 3.0E-61
sp|C3N688|PYRB_SULIA Aspartate carbamoyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=pyrB PE=3 SV=1 13 312 6.0E-61
sp|A8A8H6|PYRB_IGNH4 Aspartate carbamoyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pyrB PE=3 SV=1 15 309 1.0E-57
sp|Q47R25|PYRB_THEFY Aspartate carbamoyltransferase OS=Thermobifida fusca (strain YX) GN=pyrB PE=3 SV=1 13 312 3.0E-54
sp|A5FQE1|PYRB_DEHMB Aspartate carbamoyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pyrB PE=3 SV=1 3 310 7.0E-53
sp|A0LUG3|PYRB_ACIC1 Aspartate carbamoyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=pyrB PE=3 SV=1 13 312 9.0E-53
sp|Q3ZY97|PYRB_DEHMC Aspartate carbamoyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=pyrB PE=3 SV=1 3 310 2.0E-52
sp|B1I4N1|PYRB_DESAP Aspartate carbamoyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=pyrB PE=3 SV=1 13 312 5.0E-52
sp|Q2RK43|PYRB_MOOTA Aspartate carbamoyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=pyrB PE=3 SV=1 10 312 2.0E-51
sp|A5D1A5|PYRB_PELTS Aspartate carbamoyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pyrB PE=3 SV=1 49 311 5.0E-51
sp|Q3Z787|PYRB_DEHM1 Aspartate carbamoyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pyrB PE=3 SV=1 3 310 2.0E-50
sp|A8ZU12|PYRB_DESOH Aspartate carbamoyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=pyrB PE=3 SV=1 10 312 3.0E-50
sp|A8LY14|PYRB_SALAI Aspartate carbamoyltransferase OS=Salinispora arenicola (strain CNS-205) GN=pyrB PE=3 SV=1 13 312 5.0E-50
sp|A8LE09|PYRB_FRASN Aspartate carbamoyltransferase OS=Frankia sp. (strain EAN1pec) GN=pyrB PE=3 SV=1 13 312 7.0E-50
sp|Q0RF77|PYRB_FRAAA Aspartate carbamoyltransferase OS=Frankia alni (strain ACN14a) GN=pyrB PE=3 SV=1 12 312 4.0E-49
sp|A4X615|PYRB_SALTO Aspartate carbamoyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=pyrB PE=3 SV=1 26 312 1.0E-48
sp|Q0AXG1|PYRB_SYNWW Aspartate carbamoyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=pyrB PE=3 SV=1 10 313 3.0E-48
sp|Q01V56|PYRB_SOLUE Aspartate carbamoyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=pyrB PE=3 SV=1 15 312 4.0E-48
sp|Q0BTZ5|PYRB_GRABC Aspartate carbamoyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pyrB PE=3 SV=1 10 308 5.0E-48
sp|Q8FT39|PYRB_COREF Aspartate carbamoyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pyrB PE=3 SV=2 13 313 8.0E-48
sp|A4QEI7|PYRB_CORGB Aspartate carbamoyltransferase OS=Corynebacterium glutamicum (strain R) GN=pyrB PE=3 SV=1 13 313 9.0E-48
sp|Q6AS40|PYRB_DESPS Aspartate carbamoyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pyrB PE=3 SV=2 9 311 1.0E-47
sp|Q8NQ38|PYRB_CORGL Aspartate carbamoyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pyrB PE=3 SV=1 13 313 1.0E-47
sp|Q3A448|PYRB_PELCD Aspartate carbamoyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pyrB PE=3 SV=1 9 311 2.0E-47
sp|Q74DP5|PYRB_GEOSL Aspartate carbamoyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pyrB PE=3 SV=1 10 308 3.0E-47
sp|B2IEN5|PYRB_BEII9 Aspartate carbamoyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=pyrB PE=3 SV=1 2 308 3.0E-47
sp|B2A2U7|PYRB_NATTJ Aspartate carbamoyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pyrB PE=3 SV=1 10 308 5.0E-47
sp|P41008|PYRB_BACCL Aspartate carbamoyltransferase OS=Bacillus caldolyticus GN=pyrB PE=3 SV=2 14 312 5.0E-47
sp|B1W459|PYRB_STRGG Aspartate carbamoyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pyrB PE=3 SV=1 12 312 5.0E-47
sp|P05654|PYRB_BACSU Aspartate carbamoyltransferase OS=Bacillus subtilis (strain 168) GN=pyrB PE=1 SV=2 13 308 7.0E-47
sp|A4J555|PYRB_DESRM Aspartate carbamoyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=pyrB PE=3 SV=1 10 311 1.0E-46
sp|A6U811|PYRB_SINMW Aspartate carbamoyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=pyrB PE=3 SV=1 9 308 1.0E-46
sp|Q2J833|PYRB_FRASC Aspartate carbamoyltransferase OS=Frankia sp. (strain CcI3) GN=pyrB PE=3 SV=1 12 312 1.0E-46
sp|B9M4S3|PYRB_GEODF Aspartate carbamoyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=pyrB PE=3 SV=1 9 308 2.0E-46
sp|Q92QL5|PYRB_RHIME Aspartate carbamoyltransferase OS=Rhizobium meliloti (strain 1021) GN=pyrB PE=3 SV=1 9 308 2.0E-46
sp|Q2GKK3|PYRB_ANAPZ Aspartate carbamoyltransferase OS=Anaplasma phagocytophilum (strain HZ) GN=pyrB PE=3 SV=1 40 308 3.0E-46
sp|Q8UFT9|PYRB_AGRFC Aspartate carbamoyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pyrB PE=3 SV=2 10 308 3.0E-46
sp|B6J6M5|PYRB_COXB1 Aspartate carbamoyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=pyrB PE=3 SV=1 14 312 3.0E-46
sp|A4IM30|PYRB_GEOTN Aspartate carbamoyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pyrB PE=3 SV=1 54 308 3.0E-46
sp|Q83A16|PYRB_COXBU Aspartate carbamoyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pyrB PE=3 SV=1 14 312 3.0E-46
sp|A9NBU3|PYRB_COXBR Aspartate carbamoyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pyrB PE=3 SV=1 14 312 3.0E-46
sp|A9KDE9|PYRB_COXBN Aspartate carbamoyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pyrB PE=3 SV=1 14 312 3.0E-46
sp|B6J3V8|PYRB_COXB2 Aspartate carbamoyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=pyrB PE=3 SV=1 14 312 3.0E-46
sp|Q5L0U6|PYRB_GEOKA Aspartate carbamoyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=pyrB PE=3 SV=1 14 312 4.0E-46
sp|C5D8P7|PYRB_GEOSW Aspartate carbamoyltransferase OS=Geobacillus sp. (strain WCH70) GN=pyrB PE=3 SV=1 54 308 5.0E-46
sp|A7Z4G9|PYRB_BACMF Aspartate carbamoyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pyrB PE=3 SV=1 13 308 6.0E-46
sp|Q6AF88|PYRB_LEIXX Aspartate carbamoyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pyrB PE=3 SV=1 13 313 6.0E-46
sp|Q2W156|PYRB_MAGSA Aspartate carbamoyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pyrB PE=3 SV=2 8 311 7.0E-46
sp|Q24TJ1|PYRB_DESHY Aspartate carbamoyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=pyrB PE=3 SV=1 10 312 9.0E-46
sp|B8FT13|PYRB_DESHD Aspartate carbamoyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=pyrB PE=3 SV=1 10 312 9.0E-46
sp|A5GF41|PYRB_GEOUR Aspartate carbamoyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=pyrB PE=3 SV=1 9 308 9.0E-46
sp|Q9KXR2|PYRB_STRCO Aspartate carbamoyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pyrB PE=3 SV=1 12 312 1.0E-45
sp|B1ZLL0|PYRB_METPB Aspartate carbamoyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=pyrB PE=3 SV=1 9 308 1.0E-45
sp|Q11IM0|PYRB_CHESB Aspartate carbamoyltransferase OS=Chelativorans sp. (strain BNC1) GN=pyrB PE=3 SV=1 10 314 1.0E-45
sp|Q1J129|PYRB_DEIGD Aspartate carbamoyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=pyrB PE=3 SV=1 49 308 1.0E-45
sp|Q71YH8|PYRB_LISMF Aspartate carbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pyrB PE=3 SV=1 55 312 1.0E-45
sp|C1KWD7|PYRB_LISMC Aspartate carbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pyrB PE=3 SV=1 55 312 1.0E-45
sp|A6X568|PYRB_OCHA4 Aspartate carbamoyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pyrB PE=3 SV=1 7 314 2.0E-45
sp|B3E3I2|PYRB_GEOLS Aspartate carbamoyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pyrB PE=3 SV=1 10 308 2.0E-45
sp|A9W737|PYRB_METEP Aspartate carbamoyltransferase OS=Methylobacterium extorquens (strain PA1) GN=pyrB PE=3 SV=1 9 308 3.0E-45
sp|B7KW98|PYRB_METC4 Aspartate carbamoyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=pyrB PE=3 SV=1 9 308 3.0E-45
sp|A1SJE8|PYRB_NOCSJ Aspartate carbamoyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pyrB PE=3 SV=1 12 312 3.0E-45
sp|Q5FRG8|PYRB_GLUOX Aspartate carbamoyltransferase OS=Gluconobacter oxydans (strain 621H) GN=pyrB PE=3 SV=1 38 308 4.0E-45
sp|A0QWS1|PYRB_MYCS2 Aspartate carbamoyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pyrB PE=3 SV=1 10 308 5.0E-45
sp|Q67Q01|PYRB_SYMTH Aspartate carbamoyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pyrB PE=3 SV=1 10 306 6.0E-45
sp|B3CLL6|PYRB_WOLPP Aspartate carbamoyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=pyrB PE=3 SV=1 11 308 6.0E-45
sp|C3MA97|PYRB_RHISN Aspartate carbamoyltransferase OS=Rhizobium sp. (strain NGR234) GN=pyrB PE=3 SV=1 9 308 1.0E-44
sp|Q8Y662|PYRB_LISMO Aspartate carbamoyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pyrB PE=3 SV=1 55 312 1.0E-44
sp|A7GRL4|PYRB_BACCN Aspartate carbamoyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pyrB PE=3 SV=1 15 308 1.0E-44
sp|Q827R1|PYRB_STRAW Aspartate carbamoyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pyrB PE=3 SV=1 12 312 1.0E-44
sp|A9VTC9|PYRB_BACWK Aspartate carbamoyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pyrB PE=3 SV=1 14 308 2.0E-44
sp|Q39US4|PYRB_GEOMG Aspartate carbamoyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pyrB PE=3 SV=1 10 308 2.0E-44
sp|Q9RVC0|PYRB_DEIRA Aspartate carbamoyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pyrB PE=3 SV=1 11 308 2.0E-44
sp|A1AS13|PYRB_PELPD Aspartate carbamoyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=pyrB PE=3 SV=1 10 308 2.0E-44
sp|A5FWH1|PYRB_ACICJ Aspartate carbamoyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=pyrB PE=3 SV=1 10 308 2.0E-44
sp|Q3AC00|PYRB_CARHZ Aspartate carbamoyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pyrB PE=3 SV=1 11 311 2.0E-44
sp|A4FBG1|PYRB_SACEN Aspartate carbamoyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pyrB PE=3 SV=1 46 313 2.0E-44
sp|A7IMA0|PYRB_XANP2 Aspartate carbamoyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pyrB PE=3 SV=1 49 308 3.0E-44
sp|A4YWG4|PYRB_BRASO Aspartate carbamoyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=pyrB PE=3 SV=1 13 308 3.0E-44
sp|A4TBY0|PYRB_MYCGI Aspartate carbamoyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=pyrB PE=3 SV=1 13 308 4.0E-44
sp|Q8CPJ7|PYRB_STAES Aspartate carbamoyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pyrB PE=3 SV=1 13 312 4.0E-44
sp|Q98M86|PYRB_RHILO Aspartate carbamoyltransferase OS=Rhizobium loti (strain MAFF303099) GN=pyrB PE=3 SV=1 10 314 4.0E-44
sp|Q4JVG8|PYRB_CORJK Aspartate carbamoyltransferase OS=Corynebacterium jeikeium (strain K411) GN=pyrB PE=3 SV=1 13 308 4.0E-44
sp|A0AJU3|PYRB_LISW6 Aspartate carbamoyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pyrB PE=3 SV=1 55 312 4.0E-44
sp|A8ICW0|PYRB_AZOC5 Aspartate carbamoyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pyrB PE=3 SV=1 49 308 6.0E-44
sp|P65612|PYRB_BRUSU Aspartate carbamoyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=pyrB PE=3 SV=1 10 314 6.0E-44
sp|A9WYR8|PYRB_BRUSI Aspartate carbamoyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pyrB PE=3 SV=1 10 314 6.0E-44
sp|A5VUT1|PYRB_BRUO2 Aspartate carbamoyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pyrB PE=3 SV=1 10 314 6.0E-44
sp|P65611|PYRB_BRUME Aspartate carbamoyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pyrB PE=3 SV=1 10 314 6.0E-44
sp|C0RLC0|PYRB_BRUMB Aspartate carbamoyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pyrB PE=3 SV=1 10 314 6.0E-44
sp|Q577Z8|PYRB_BRUAB Aspartate carbamoyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=pyrB PE=3 SV=1 10 314 6.0E-44
sp|Q2YKL8|PYRB_BRUA2 Aspartate carbamoyltransferase OS=Brucella abortus (strain 2308) GN=pyrB PE=3 SV=1 10 314 6.0E-44
sp|B2SB57|PYRB_BRUA1 Aspartate carbamoyltransferase OS=Brucella abortus (strain S19) GN=pyrB PE=3 SV=1 10 314 6.0E-44
sp|A9MBN9|PYRB_BRUC2 Aspartate carbamoyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pyrB PE=3 SV=1 10 314 7.0E-44
sp|Q5HPZ1|PYRB_STAEQ Aspartate carbamoyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pyrB PE=3 SV=1 13 312 7.0E-44
sp|C0QJ55|PYRB_DESAH Aspartate carbamoyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=pyrB PE=3 SV=1 10 311 7.0E-44
sp|A7GXT8|PYRB_CAMC5 Aspartate carbamoyltransferase OS=Campylobacter curvus (strain 525.92) GN=pyrB PE=3 SV=1 10 308 8.0E-44
sp|A1W085|PYRB_CAMJJ Aspartate carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pyrB PE=3 SV=1 13 308 9.0E-44
sp|Q1IHT1|PYRB_KORVE Aspartate carbamoyltransferase OS=Koribacter versatilis (strain Ellin345) GN=pyrB PE=3 SV=1 47 313 1.0E-43
sp|A8FMF1|PYRB_CAMJ8 Aspartate carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=pyrB PE=3 SV=1 13 308 1.0E-43
sp|Q8R9R5|PYRB_CALS4 Aspartate carbamoyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pyrB PE=3 SV=1 12 311 1.0E-43
sp|Q1GUN0|PYRB_SPHAL Aspartate carbamoyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pyrB PE=3 SV=1 9 311 1.0E-43
sp|C4LIU1|PYRB_CORK4 Aspartate carbamoyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=pyrB PE=3 SV=1 13 308 1.0E-43
sp|B3PW37|PYRB_RHIE6 Aspartate carbamoyltransferase OS=Rhizobium etli (strain CIAT 652) GN=pyrB PE=3 SV=1 10 308 1.0E-43
sp|A0RHR1|PYRB_BACAH Aspartate carbamoyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|Q6HES5|PYRB_BACHK Aspartate carbamoyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|Q636D7|PYRB_BACCZ Aspartate carbamoyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|B9IVW6|PYRB_BACCQ Aspartate carbamoyltransferase OS=Bacillus cereus (strain Q1) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|B7HLM3|PYRB_BACC7 Aspartate carbamoyltransferase OS=Bacillus cereus (strain AH187) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|B7H6M5|PYRB_BACC4 Aspartate carbamoyltransferase OS=Bacillus cereus (strain B4264) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|B7JJX6|PYRB_BACC0 Aspartate carbamoyltransferase OS=Bacillus cereus (strain AH820) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|Q81WE9|PYRB_BACAN Aspartate carbamoyltransferase OS=Bacillus anthracis GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|C3L737|PYRB_BACAC Aspartate carbamoyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|C3P659|PYRB_BACAA Aspartate carbamoyltransferase OS=Bacillus anthracis (strain A0248) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|A5UX78|PYRB_ROSS1 Aspartate carbamoyltransferase OS=Roseiflexus sp. (strain RS-1) GN=pyrB PE=3 SV=1 11 308 2.0E-43
sp|C1EPQ3|PYRB_BACC3 Aspartate carbamoyltransferase OS=Bacillus cereus (strain 03BB102) GN=pyrB PE=3 SV=1 14 308 2.0E-43
sp|A0JX76|PYRB_ARTS2 Aspartate carbamoyltransferase OS=Arthrobacter sp. (strain FB24) GN=pyrB PE=3 SV=1 13 313 2.0E-43
sp|Q65JV0|PYRB_BACLD Aspartate carbamoyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pyrB PE=3 SV=1 13 308 2.0E-43
sp|A0LK21|PYRB_SYNFM Aspartate carbamoyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pyrB PE=3 SV=1 49 311 2.0E-43
sp|A6Q1Y1|PYRB_NITSB Aspartate carbamoyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=pyrB PE=3 SV=1 13 312 2.0E-43
sp|B1VDM8|PYRB_CORU7 Aspartate carbamoyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=pyrB PE=3 SV=1 46 308 3.0E-43
sp|A5EKQ8|PYRB_BRASB Aspartate carbamoyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pyrB PE=3 SV=1 13 308 3.0E-43
sp|Q819S0|PYRB_BACCR Aspartate carbamoyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pyrB PE=3 SV=1 54 308 4.0E-43
sp|Q5HU06|PYRB_CAMJR Aspartate carbamoyltransferase OS=Campylobacter jejuni (strain RM1221) GN=pyrB PE=3 SV=1 13 308 4.0E-43
sp|Q1MIH6|PYRB_RHIL3 Aspartate carbamoyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pyrB PE=3 SV=1 10 308 4.0E-43
sp|B5ZYQ2|PYRB_RHILW Aspartate carbamoyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pyrB PE=3 SV=1 10 308 4.0E-43
sp|B9JDM0|PYRB_AGRRK Aspartate carbamoyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pyrB PE=3 SV=1 10 308 4.0E-43
sp|B8DDR4|PYRB_LISMH Aspartate carbamoyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pyrB PE=3 SV=1 56 312 5.0E-43
sp|Q89K19|PYRB_BRADU Aspartate carbamoyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pyrB PE=3 SV=1 13 308 5.0E-43
sp|Q9PNJ6|PYRB_CAMJE Aspartate carbamoyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pyrB PE=3 SV=1 13 308 5.0E-43
sp|Q732I0|PYRB_BACC1 Aspartate carbamoyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pyrB PE=3 SV=1 14 308 6.0E-43
sp|A1T8G7|PYRB_MYCVP Aspartate carbamoyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pyrB PE=3 SV=1 13 308 6.0E-43
sp|B7IUP9|PYRB_BACC2 Aspartate carbamoyltransferase OS=Bacillus cereus (strain G9842) GN=pyrB PE=3 SV=1 14 308 7.0E-43
sp|B5EB49|PYRB_GEOBB Aspartate carbamoyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=pyrB PE=3 SV=1 10 308 7.0E-43
sp|Q5PAN5|PYRB_ANAMM Aspartate carbamoyltransferase OS=Anaplasma marginale (strain St. Maries) GN=pyrB PE=3 SV=1 47 308 8.0E-43
sp|A8ERG2|PYRB_ARCB4 Aspartate carbamoyltransferase OS=Arcobacter butzleri (strain RM4018) GN=pyrB PE=3 SV=1 13 308 8.0E-43
sp|A1R6Z7|PYRB_ARTAT Aspartate carbamoyltransferase OS=Arthrobacter aurescens (strain TC1) GN=pyrB PE=3 SV=1 13 313 9.0E-43
sp|A0M2G8|PYRB_GRAFK Aspartate carbamoyltransferase OS=Gramella forsetii (strain KT0803) GN=pyrB PE=3 SV=1 14 315 9.0E-43
sp|A7HX10|PYRB_PARL1 Aspartate carbamoyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pyrB PE=3 SV=2 6 308 9.0E-43
sp|Q6NH13|PYRB_CORDI Aspartate carbamoyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pyrB PE=3 SV=1 13 313 9.0E-43
sp|B2HNE6|PYRB_MYCMM Aspartate carbamoyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pyrB PE=3 SV=1 10 308 9.0E-43
sp|A7ZEC2|PYRB_CAMC1 Aspartate carbamoyltransferase OS=Campylobacter concisus (strain 13826) GN=pyrB PE=3 SV=1 10 308 1.0E-42
sp|Q2K9P5|PYRB_RHIEC Aspartate carbamoyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pyrB PE=3 SV=1 10 308 1.0E-42
sp|Q2S2X3|PYRB_SALRD Aspartate carbamoyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pyrB PE=3 SV=1 4 314 1.0E-42
sp|Q1QL23|PYRB_NITHX Aspartate carbamoyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pyrB PE=3 SV=1 13 308 1.0E-42
sp|Q5LX75|PYRB_RUEPO Aspartate carbamoyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pyrB PE=3 SV=1 9 311 1.0E-42
sp|C0R3U0|PYRB_WOLWR Aspartate carbamoyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=pyrB PE=3 SV=1 11 308 1.0E-42
sp|Q73GP1|PYRB_WOLPM Aspartate carbamoyltransferase OS=Wolbachia pipientis wMel GN=pyrB PE=3 SV=1 11 308 1.0E-42
sp|A8FD14|PYRB_BACP2 Aspartate carbamoyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=pyrB PE=3 SV=1 17 308 1.0E-42
sp|A7H2Q9|PYRB_CAMJD Aspartate carbamoyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=pyrB PE=3 SV=1 13 308 2.0E-42
sp|A0PPI8|PYRB_MYCUA Aspartate carbamoyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=pyrB PE=3 SV=1 10 308 2.0E-42
sp|A6QC00|PYRB_SULNB Aspartate carbamoyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=pyrB PE=3 SV=1 13 312 2.0E-42
sp|A7HCE9|PYRB_ANADF Aspartate carbamoyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pyrB PE=3 SV=1 11 311 2.0E-42
sp|Q07L79|PYRB_RHOP5 Aspartate carbamoyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=pyrB PE=3 SV=1 13 308 2.0E-42
sp|C5CCF5|PYRB_MICLC Aspartate carbamoyltransferase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=pyrB PE=3 SV=1 13 312 2.0E-42
sp|B8G8T0|PYRB_CHLAD Aspartate carbamoyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pyrB PE=3 SV=1 11 308 2.0E-42
sp|Q215Y5|PYRB_RHOPB Aspartate carbamoyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=pyrB PE=3 SV=1 9 308 3.0E-42
sp|C6DZ52|PYRB_GEOSM Aspartate carbamoyltransferase OS=Geobacter sp. (strain M21) GN=pyrB PE=3 SV=1 10 308 3.0E-42
sp|A4XKT1|PYRB_CALS8 Aspartate carbamoyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=pyrB PE=3 SV=1 13 310 3.0E-42
sp|B9LFU5|PYRB_CHLSY Aspartate carbamoyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pyrB PE=3 SV=1 12 308 3.0E-42
sp|A9WDU7|PYRB_CHLAA Aspartate carbamoyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pyrB PE=3 SV=1 12 308 3.0E-42
sp|B9KCT6|PYRB_CAMLR Aspartate carbamoyltransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=pyrB PE=3 SV=1 13 308 3.0E-42
sp|Q0ANY2|PYRB_MARMM Aspartate carbamoyltransferase OS=Maricaulis maris (strain MCS10) GN=pyrB PE=3 SV=1 10 313 3.0E-42
sp|B4UDQ3|PYRB_ANASK Aspartate carbamoyltransferase OS=Anaeromyxobacter sp. (strain K) GN=pyrB PE=3 SV=1 11 311 3.0E-42
sp|Q9A5K4|PYRB_CAUCR Aspartate carbamoyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pyrB PE=3 SV=1 9 313 3.0E-42
sp|C3PG15|PYRB_CORA7 Aspartate carbamoyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=pyrB PE=3 SV=1 13 308 4.0E-42
sp|A4WP19|PYRB_RHOS5 Aspartate carbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=pyrB PE=3 SV=1 10 311 4.0E-42
sp|B8H8U9|PYRB_ARTCA Aspartate carbamoyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=pyrB PE=3 SV=1 13 313 4.0E-42
sp|Q741H5|PYRB_MYCPA Aspartate carbamoyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pyrB PE=3 SV=1 13 308 4.0E-42
sp|A0QI37|PYRB_MYCA1 Aspartate carbamoyltransferase OS=Mycobacterium avium (strain 104) GN=pyrB PE=3 SV=1 13 308 4.0E-42
sp|A5CRX9|PYRB_CLAM3 Aspartate carbamoyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=pyrB PE=3 SV=1 13 313 4.0E-42
sp|B6IN31|PYRB_RHOCS Aspartate carbamoyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pyrB PE=3 SV=1 8 311 4.0E-42
sp|Q163C5|PYRB_ROSDO Aspartate carbamoyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pyrB PE=3 SV=2 9 311 4.0E-42
sp|B3Q9X4|PYRB_RHOPT Aspartate carbamoyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=pyrB PE=3 SV=1 13 308 5.0E-42
sp|Q6N565|PYRB_RHOPA Aspartate carbamoyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pyrB PE=3 SV=1 13 308 5.0E-42
sp|B0T190|PYRB_CAUSK Aspartate carbamoyltransferase OS=Caulobacter sp. (strain K31) GN=pyrB PE=3 SV=1 9 309 5.0E-42
sp|A9GZR7|PYRB_GLUDA Aspartate carbamoyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=pyrB PE=3 SV=1 47 311 5.0E-42
sp|B9JVI4|PYRB_AGRVS Aspartate carbamoyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pyrB PE=3 SV=1 10 308 5.0E-42
sp|Q3SR25|PYRB_NITWN Aspartate carbamoyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pyrB PE=3 SV=2 13 308 5.0E-42
sp|Q135I5|PYRB_RHOPS Aspartate carbamoyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=pyrB PE=3 SV=1 4 308 6.0E-42
sp|B1GYY8|PYRB_UNCTG Aspartate carbamoyltransferase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=pyrB PE=3 SV=1 49 311 6.0E-42
sp|B9KNE8|PYRB_RHOSK Aspartate carbamoyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pyrB PE=3 SV=1 10 311 6.0E-42
sp|Q3IZ49|PYRB_RHOS4 Aspartate carbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pyrB PE=3 SV=1 10 311 6.0E-42
sp|A3PN48|PYRB_RHOS1 Aspartate carbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pyrB PE=3 SV=1 10 311 6.0E-42
sp|A5FB79|PYRB_FLAJ1 Aspartate carbamoyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pyrB PE=3 SV=1 14 315 7.0E-42
sp|Q4L5Q2|PYRB_STAHJ Aspartate carbamoyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pyrB PE=3 SV=1 13 313 7.0E-42
sp|Q1D6L9|PYRB_MYXXD Aspartate carbamoyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=pyrB PE=3 SV=1 13 313 7.0E-42
sp|Q2IXD1|PYRB_RHOP2 Aspartate carbamoyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=pyrB PE=3 SV=1 4 308 8.0E-42
sp|A3DE08|PYRB_CLOTH Aspartate carbamoyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=pyrB PE=3 SV=1 9 311 1.0E-41
sp|B8JAE9|PYRB_ANAD2 Aspartate carbamoyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pyrB PE=3 SV=1 11 311 1.0E-41
sp|B9MS21|PYRB_CALBD Aspartate carbamoyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=pyrB PE=3 SV=1 13 310 2.0E-41
sp|B5YA17|PYRB_COPPD Aspartate carbamoyltransferase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=pyrB PE=3 SV=1 13 312 2.0E-41
sp|Q6G3F3|PYRB_BARHE Aspartate carbamoyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pyrB PE=3 SV=1 8 308 2.0E-41
sp|B0REW3|PYRB_CLAMS Aspartate carbamoyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=pyrB PE=3 SV=1 13 313 2.0E-41
sp|A9IU46|PYRB_BART1 Aspartate carbamoyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pyrB PE=3 SV=1 10 308 2.0E-41
sp|Q2IIB1|PYRB_ANADE Aspartate carbamoyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pyrB PE=3 SV=1 11 311 2.0E-41
sp|A9GWW0|PYRB_SORC5 Aspartate carbamoyltransferase OS=Sorangium cellulosum (strain So ce56) GN=pyrB PE=3 SV=1 9 313 2.0E-41
sp|B6JFV4|PYRB_OLICO Aspartate carbamoyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=pyrB PE=3 SV=1 13 308 2.0E-41
sp|Q4FLQ4|PYRB_PELUB Aspartate carbamoyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=pyrB PE=3 SV=1 10 310 2.0E-41
sp|B2ULR3|PYRB_AKKM8 Aspartate carbamoyltransferase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=pyrB PE=3 SV=1 12 308 2.0E-41
sp|Q9K9V6|PYRB_BACHD Aspartate carbamoyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrB PE=3 SV=1 12 308 2.0E-41
sp|A3PZ61|PYRB_MYCSJ Aspartate carbamoyltransferase OS=Mycobacterium sp. (strain JLS) GN=pyrB PE=3 SV=1 46 308 3.0E-41
sp|B1MCD9|PYRB_MYCA9 Aspartate carbamoyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=pyrB PE=3 SV=1 13 308 3.0E-41
sp|Q9CCR5|PYRB_MYCLE Aspartate carbamoyltransferase OS=Mycobacterium leprae (strain TN) GN=pyrB PE=3 SV=1 12 308 3.0E-41
sp|B8ZUL1|PYRB_MYCLB Aspartate carbamoyltransferase OS=Mycobacterium leprae (strain Br4923) GN=pyrB PE=3 SV=1 12 308 3.0E-41
sp|Q1B9G3|PYRB_MYCSS Aspartate carbamoyltransferase OS=Mycobacterium sp. (strain MCS) GN=pyrB PE=3 SV=1 46 308 3.0E-41
sp|A1UFK0|PYRB_MYCSK Aspartate carbamoyltransferase OS=Mycobacterium sp. (strain KMS) GN=pyrB PE=3 SV=1 46 308 3.0E-41
sp|Q30TD9|PYRB_SULDN Aspartate carbamoyltransferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=pyrB PE=3 SV=1 48 308 4.0E-41
sp|C5C683|PYRB_BEUC1 Aspartate carbamoyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=pyrB PE=3 SV=1 13 313 4.0E-41
sp|P65619|PYRB_STAAW Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain MW2) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|A8Z3N7|PYRB_STAAT Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|Q6GA13|PYRB_STAAS Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|Q6GHN5|PYRB_STAAR Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|P65618|PYRB_STAAN Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain N315) GN=pyrB PE=1 SV=1 13 308 4.0E-41
sp|P65617|PYRB_STAAM Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|A6QGA1|PYRB_STAAE Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain Newman) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|Q5HGN2|PYRB_STAAC Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain COL) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|A5IS85|PYRB_STAA9 Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain JH9) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|Q2FZ75|PYRB_STAA8 Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|Q2FHN8|PYRB_STAA3 Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain USA300) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|A6U119|PYRB_STAA2 Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain JH1) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|A7X1E9|PYRB_STAA1 Aspartate carbamoyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pyrB PE=3 SV=1 13 308 4.0E-41
sp|B1ZT05|PYRB_OPITP Aspartate carbamoyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=pyrB PE=3 SV=1 10 310 5.0E-41
sp|Q38X27|PYRB_LACSS Aspartate carbamoyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pyrB PE=3 SV=1 15 312 6.0E-41
sp|Q8RG89|PYRB_FUSNN Aspartate carbamoyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pyrB PE=3 SV=1 10 312 6.0E-41
sp|A4SDL1|PYRB_CHLPM Aspartate carbamoyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=pyrB PE=3 SV=1 49 312 7.0E-41
sp|P9WIT7|PYRB_MYCTU Aspartate carbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pyrB PE=1 SV=1 46 308 7.0E-41
sp|P9WIT6|PYRB_MYCTO Aspartate carbamoyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pyrB PE=3 SV=1 46 308 7.0E-41
sp|A5U282|PYRB_MYCTA Aspartate carbamoyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pyrB PE=3 SV=1 46 308 7.0E-41
sp|C1AN25|PYRB_MYCBT Aspartate carbamoyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pyrB PE=3 SV=1 46 308 7.0E-41
sp|A1KIG9|PYRB_MYCBP Aspartate carbamoyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pyrB PE=3 SV=1 46 308 7.0E-41
sp|P65614|PYRB_MYCBO Aspartate carbamoyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pyrB PE=3 SV=1 46 308 7.0E-41
sp|B0TGQ3|PYRB_HELMI Aspartate carbamoyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=pyrB PE=3 SV=1 9 313 8.0E-41
sp|C1A8J7|PYRB_GEMAT Aspartate carbamoyltransferase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=pyrB PE=3 SV=1 49 311 9.0E-41
sp|Q1WVB2|PYRB_LACS1 Aspartate carbamoyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=pyrB PE=3 SV=1 54 312 9.0E-41
sp|Q2RPG0|PYRB_RHORT Aspartate carbamoyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pyrB PE=3 SV=1 45 308 1.0E-40
sp|A6WCD0|PYRB_KINRD Aspartate carbamoyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=pyrB PE=3 SV=2 13 313 1.0E-40
sp|Q8YWD2|PYRB_NOSS1 Aspartate carbamoyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pyrB PE=3 SV=1 8 311 2.0E-40
sp|B9DPM9|PYRB_STACT Aspartate carbamoyltransferase OS=Staphylococcus carnosus (strain TM300) GN=pyrB PE=3 SV=1 13 313 2.0E-40
sp|Q2G3S7|PYRB_NOVAD Aspartate carbamoyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pyrB PE=3 SV=1 9 311 2.0E-40
sp|Q59653|PYRB_PSEAE Aspartate carbamoyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pyrB PE=3 SV=2 13 313 2.0E-40
sp|Q02U10|PYRB_PSEAB Aspartate carbamoyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pyrB PE=3 SV=1 13 313 2.0E-40
sp|B7V3Y9|PYRB_PSEA8 Aspartate carbamoyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=pyrB PE=3 SV=1 13 313 2.0E-40
sp|Q8ER38|PYRB_OCEIH Aspartate carbamoyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pyrB PE=3 SV=1 13 313 2.0E-40
sp|A6UYL2|PYRB_PSEA7 Aspartate carbamoyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=pyrB PE=3 SV=1 13 313 2.0E-40
sp|C3K3K2|PYRB_PSEFS Aspartate carbamoyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=pyrB PE=3 SV=1 13 313 2.0E-40
sp|Q92AH0|PYRB_LISIN Aspartate carbamoyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pyrB PE=3 SV=1 55 312 2.0E-40
sp|Q0VTM5|PYRB_ALCBS Aspartate carbamoyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pyrB PE=3 SV=1 11 313 2.0E-40
sp|Q59711|PYRB_PSEPU Aspartate carbamoyltransferase OS=Pseudomonas putida GN=pyrB PE=3 SV=1 13 313 3.0E-40
sp|Q1I3U2|PYRB_PSEE4 Aspartate carbamoyltransferase OS=Pseudomonas entomophila (strain L48) GN=pyrB PE=3 SV=1 13 313 3.0E-40
sp|Q3SFS1|PYRB_THIDA Aspartate carbamoyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pyrB PE=3 SV=1 13 311 3.0E-40
sp|Q6FZS5|PYRB_BARQU Aspartate carbamoyltransferase OS=Bartonella quintana (strain Toulouse) GN=pyrB PE=3 SV=1 10 308 3.0E-40
sp|B0KM23|PYRB_PSEPG Aspartate carbamoyltransferase OS=Pseudomonas putida (strain GB-1) GN=pyrB PE=3 SV=1 13 313 3.0E-40
sp|B8I769|PYRB_CLOCE Aspartate carbamoyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pyrB PE=3 SV=1 10 311 3.0E-40
sp|Q28KE3|PYRB_JANSC Aspartate carbamoyltransferase OS=Jannaschia sp. (strain CCS1) GN=pyrB PE=3 SV=1 10 311 3.0E-40
sp|B1J355|PYRB_PSEPW Aspartate carbamoyltransferase OS=Pseudomonas putida (strain W619) GN=pyrB PE=3 SV=1 13 313 3.0E-40
sp|Q3MDY8|PYRB_ANAVT Aspartate carbamoyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pyrB PE=3 SV=1 8 311 4.0E-40
sp|P77883|PYRB_LACPL Aspartate carbamoyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrB PE=3 SV=1 13 313 5.0E-40
sp|B8CWM4|PYRB_HALOH Aspartate carbamoyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=pyrB PE=3 SV=1 9 311 5.0E-40
sp|Q727F4|PYRB_DESVH Aspartate carbamoyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pyrB PE=3 SV=1 8 311 7.0E-40
sp|A6H0I8|PYRB_FLAPJ Aspartate carbamoyltransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pyrB PE=3 SV=1 13 315 8.0E-40
sp|A1UT24|PYRB_BARBK Aspartate carbamoyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pyrB PE=3 SV=1 48 314 8.0E-40
sp|Q8DZQ5|PYRB_STRA5 Aspartate carbamoyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pyrB PE=3 SV=1 54 312 1.0E-39
sp|Q8E5F3|PYRB_STRA3 Aspartate carbamoyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pyrB PE=3 SV=1 54 312 1.0E-39
sp|Q3K148|PYRB_STRA1 Aspartate carbamoyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pyrB PE=3 SV=1 54 312 1.0E-39
sp|Q5N3S1|PYRB_SYNP6 Aspartate carbamoyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=pyrB PE=3 SV=1 8 313 1.0E-39
sp|Q31QG7|PYRB_SYNE7 Aspartate carbamoyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=pyrB PE=3 SV=1 8 313 1.0E-39
sp|A7NLW6|PYRB_ROSCS Aspartate carbamoyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pyrB PE=3 SV=1 49 308 1.0E-39
sp|A4VRI1|PYRB_PSEU5 Aspartate carbamoyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=pyrB PE=3 SV=1 13 313 1.0E-39
sp|P56585|PYRB_PSEFA Aspartate carbamoyltransferase OS=Pseudomonas fluorescens biotype A GN=pyrB PE=1 SV=2 13 313 2.0E-39
sp|Q2LVI4|PYRB_SYNAS Aspartate carbamoyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=pyrB PE=3 SV=2 10 311 2.0E-39
sp|Q88D30|PYRB_PSEPK Aspartate carbamoyltransferase OS=Pseudomonas putida (strain KT2440) GN=pyrB PE=3 SV=1 13 313 2.0E-39
sp|A5WA32|PYRB_PSEP1 Aspartate carbamoyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pyrB PE=3 SV=1 13 313 2.0E-39
sp|C1DI75|PYRB_AZOVD Aspartate carbamoyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pyrB PE=3 SV=1 13 313 2.0E-39
sp|Q3YS44|PYRB_EHRCJ Aspartate carbamoyltransferase OS=Ehrlichia canis (strain Jake) GN=pyrB PE=3 SV=1 15 308 2.0E-39
sp|Q2NDE3|PYRB_ERYLH Aspartate carbamoyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=pyrB PE=3 SV=1 10 311 2.0E-39
sp|P96079|PYRB_THEAQ Aspartate carbamoyltransferase OS=Thermus aquaticus GN=pyrB PE=3 SV=1 13 308 2.0E-39
sp|Q8KBI7|PYRB_CHLTE Aspartate carbamoyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pyrB PE=3 SV=1 48 313 2.0E-39
sp|A9WSB2|PYRB_RENSM Aspartate carbamoyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=pyrB PE=3 SV=1 13 313 2.0E-39
sp|B2G5A1|PYRB_LACRJ Aspartate carbamoyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=pyrB PE=3 SV=1 55 312 3.0E-39
sp|A5VHS1|PYRB_LACRD Aspartate carbamoyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=pyrB PE=3 SV=1 55 312 3.0E-39
sp|Q5GSQ1|PYRB_WOLTR Aspartate carbamoyltransferase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=pyrB PE=3 SV=1 11 308 3.0E-39
sp|A1VAM1|PYRB_DESVV Aspartate carbamoyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=pyrB PE=3 SV=1 8 311 3.0E-39
sp|B9EB66|PYRB_MACCJ Aspartate carbamoyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=pyrB PE=3 SV=1 56 312 4.0E-39
sp|A4XPA4|PYRB_PSEMY Aspartate carbamoyltransferase OS=Pseudomonas mendocina (strain ymp) GN=pyrB PE=3 SV=1 13 313 5.0E-39
sp|Q0BZU6|PYRB_HYPNA Aspartate carbamoyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=pyrB PE=3 SV=1 10 311 5.0E-39
sp|Q4ZZ70|PYRB_PSEU2 Aspartate carbamoyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pyrB PE=3 SV=1 13 313 6.0E-39
sp|Q5SK66|PYRB_THET8 Aspartate carbamoyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pyrB PE=3 SV=1 13 308 6.0E-39
[Show less]

GO

GO Term Description Terminal node
GO:0016597 amino acid binding Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0016743 carboxyl- or carbamoyltransferase activity Yes
GO:0019752 carboxylic acid metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0031406 carboxylic acid binding No
GO:0006082 organic acid metabolic process No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0043177 organic acid binding No
GO:0043167 ion binding No
GO:0044281 small molecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10315
MQLLSQPSCFKKQHVLSVGQYTRADLHLLFTVAQEMRLGVQRSGVLDLLRGRVLCTLFYEPSTRTSASFDAAMQR
LGGRTVAVAAGQSSVQKGETLQDTLRTLACYGDAVVLRHPDEGSVEVAERYSDVPVINAGNGSGEHPTQAFLDLF
TIREELGTVQGLTITFVGDLRHGRTVHSLVRLLRHYQVRVQLVAPPGLELPEGVREELAASGKLRGEWAALTGEV
ISRSDVLYCTRVQRERFGSGDEYERVRGAYRVDNAALKHAKASMVVMHPLPRNDEVAEEVDFDQRAAYFRQMRYG
LYCRMALLALVMAPM*
Coding >Hirsu2|10315
ATGCAGCTCCTGTCGCAGCCGTCGTGCTTCAAGAAGCAGCACGTGCTGTCGGTCGGGCAGTACACGCGGGCGGAC
CTGCACCTGCTGTTCACGGTGGCGCAGGAGATGCGGCTCGGGGTGCAGCGGTCGGGGGTGCTGGACCTGCTCCGG
GGCAGGGTGCTGTGCACGCTCTTCTACGAGCCGTCGACGCGGACGTCGGCGTCGTTCGACGCGGCGATGCAGCGG
CTCGGGGGCCGGACGGTGGCGGTGGCGGCCGGGCAGTCGTCGGTGCAGAAGGGCGAGACGCTGCAGGACACGCTG
CGGACGCTGGCGTGCTACGGCGACGCGGTGGTGCTGCGGCACCCGGACGAGGGCTCGGTCGAGGTGGCGGAGCGG
TACAGCGACGTGCCGGTGATCAACGCGGGCAACGGCAGCGGCGAGCACCCGACGCAGGCCTTCCTCGACCTCTTC
ACCATCCGCGAGGAGCTGGGGACGGTGCAGGGGCTGACGATCACGTTCGTGGGCGACCTGCGGCACGGGCGGACG
GTGCACTCGCTGGTGCGGCTGCTGCGGCACTACCAGGTGCGGGTGCAGCTGGTGGCGCCGCCGGGGCTGGAGCTG
CCGGAGGGCGTGCGCGAGGAGCTGGCGGCGTCGGGCAAGCTGCGCGGCGAGTGGGCGGCGCTGACGGGCGAGGTG
ATATCGCGCAGCGACGTGCTGTACTGCACGCGCGTGCAGCGGGAGCGCTTCGGCAGCGGCGACGAGTACGAGCGC
GTGCGCGGCGCGTACCGGGTCGACAACGCGGCGCTGAAGCACGCCAAGGCGTCGATGGTGGTGATGCACCCGCTG
CCGCGCAACGACGAGGTGGCCGAGGAGGTCGACTTCGACCAGCGGGCCGCCTACTTTCGACAGATGCGGTACGGG
CTCTACTGCCGGATGGCGCTGCTGGCGCTCGTCATGGCGCCGATGTGA
Transcript >Hirsu2|10315
ATGCAGCTCCTGTCGCAGCCGTCGTGCTTCAAGAAGCAGCACGTGCTGTCGGTCGGGCAGTACACGCGGGCGGAC
CTGCACCTGCTGTTCACGGTGGCGCAGGAGATGCGGCTCGGGGTGCAGCGGTCGGGGGTGCTGGACCTGCTCCGG
GGCAGGGTGCTGTGCACGCTCTTCTACGAGCCGTCGACGCGGACGTCGGCGTCGTTCGACGCGGCGATGCAGCGG
CTCGGGGGCCGGACGGTGGCGGTGGCGGCCGGGCAGTCGTCGGTGCAGAAGGGCGAGACGCTGCAGGACACGCTG
CGGACGCTGGCGTGCTACGGCGACGCGGTGGTGCTGCGGCACCCGGACGAGGGCTCGGTCGAGGTGGCGGAGCGG
TACAGCGACGTGCCGGTGATCAACGCGGGCAACGGCAGCGGCGAGCACCCGACGCAGGCCTTCCTCGACCTCTTC
ACCATCCGCGAGGAGCTGGGGACGGTGCAGGGGCTGACGATCACGTTCGTGGGCGACCTGCGGCACGGGCGGACG
GTGCACTCGCTGGTGCGGCTGCTGCGGCACTACCAGGTGCGGGTGCAGCTGGTGGCGCCGCCGGGGCTGGAGCTG
CCGGAGGGCGTGCGCGAGGAGCTGGCGGCGTCGGGCAAGCTGCGCGGCGAGTGGGCGGCGCTGACGGGCGAGGTG
ATATCGCGCAGCGACGTGCTGTACTGCACGCGCGTGCAGCGGGAGCGCTTCGGCAGCGGCGACGAGTACGAGCGC
GTGCGCGGCGCGTACCGGGTCGACAACGCGGCGCTGAAGCACGCCAAGGCGTCGATGGTGGTGATGCACCCGCTG
CCGCGCAACGACGAGGTGGCCGAGGAGGTCGACTTCGACCAGCGGGCCGCCTACTTTCGACAGATGCGGTACGGG
CTCTACTGCCGGATGGCGCTGCTGGCGCTCGTCATGGCGCCGATGTGA
Gene >Hirsu2|10315
ATGCAGCTCCTGTCGCAGCCGTCGTGCTTCAAGAAGCAGCACGTGCTGTCGGTCGGGCAGTACACGCGGGCGGAC
CTGCACCTGCTGTTCACGGTGGCGCAGGAGATGCGGCTCGGGGTGCAGCGGTCGGGGGTGCTGGACCTGCTCCGG
GGCAGGGTGCTGTGCACGCTCTTCTACGAGCCGTCGACGCGGACGTCGGCGTCGTTCGACGCGGCGATGCAGCGG
CTCGGGGGCCGGACGGTGGCGGTGGCGGCCGGGCAGTCGTCGGTGCAGAAGGGCGAGACGCTGCAGGACACGCTG
CGGACGCTGGCGTGCTACGGCGACGCGGTGGTGCTGCGGCACCCGGACGAGGGCTCGGTCGAGGTGGCGGAGCGG
TACAGCGACGTGCCGGTGATCAACGCGGGCAACGGCAGCGGCGAGCACCCGACGCAGGCCTTCCTCGACCTCTTC
ACCATCCGCGAGGAGCTGGGGACGGTGCAGGGGCTGACGATCACGTTCGTGGGCGACCTGCGGCACGGGCGGACG
GTGCACTCGCTGGTGCGGCTGCTGCGGCACTACCAGGTGCGGGTGCAGCTGGTGGCGCCGCCGGGGCTGGAGCTG
CCGGAGGGCGTGCGCGAGGAGCTGGCGGCGTCGGGCAAGCTGCGCGGCGAGTGGGCGGCGCTGACGGGCGAGGTG
ATATCGCGCAGCGACGTGCTGTACTGCACGCGCGTGCAGCGGGAGCGCTTCGGCAGCGGCGACGAGTACGAGCGC
GTGCGCGGCGCGTACCGGGTCGACAACGCGGCGCTGAAGCACGCCAAGGCGTCGATGGTGGTGATGCACCCGCTG
CCGCGCAACGACGAGGTGGCCGAGGAGGTCGACTTCGACCAGCGGGCCGCCTACTTTCGACAGGTAAGGACGGGC
AGTGATGCCGCGAGAACAGGGGGCGAGCTGACCCGGGCACGACACAGATGCGGTACGGGCTCTACTGCCGGATGG
CGCTGCTGGCGCTCGTCATGGCGCCGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail