Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|103
Gene name
LocationContig_1014:4441..4879
Strand+
Gene length (bp)438
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07544 Med9 RNA polymerase II transcription mediator complex subunit 9 1.7E-17 58 121

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003712 transcription coregulator activity Yes
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0140110 transcription regulator activity No
GO:0032991 protein-containing complex No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0019222 regulation of metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0065007 biological regulation No
GO:0140513 nuclear protein-containing complex No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0080090 regulation of primary metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal|Nuclear export signal 0.4478 0.8559 0.0353 0.0179 0.133 0.001 0.1057 0.1008 0.1211 0.0228

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1177
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2742
Ophiocordyceps australis map64 (Brazil) OphauB2|6595
Ophiocordyceps camponoti-floridani Ophcf2|05199
Ophiocordyceps camponoti-floridani Ophcf2|05200
Ophiocordyceps camponoti-rufipedis Ophun1|5096
Ophiocordyceps kimflemingae Ophio5|4712
Ophiocordyceps subramaniannii Hirsu2|103 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|103
MAAQQQPQQSLALPPTLSPDNLDTLSELSVVLAKVRAGIQSSTGITIATGATPGGPSTNGQQLSFKDVPGATDGL
KHKLQHARAQVRLLPDMARSVDDQQREIDELEARIHQQRLLLARLRDGGVGFGKDESVAATAADVKMENM*
Coding >Hirsu2|103
ATGGCCGCCCAGCAGCAACCGCAGCAGTCGCTCGCCCTCCCGCCCACGCTCTCCCCCGACAACCTCGACACCCTG
TCCGAGCTGTCCGTCGTGCTGGCCAAGGTCCGCGCCGGCATCCAGTCGTCGACGGGCATCACCATCGCCACCGGC
GCCACGCCCGGCGGGCCCAGCACCAACGGCCAGCAGCTCTCCTTCAAGGACGTGCCCGGCGCCACCGACGGCCTC
AAGCACAAGCTGCAGCACGCCAGGGCCCAGGTCCGCCTCCTGCCGGACATGGCCAGGTCCGTCGACGACCAGCAG
CGCGAGATCGACGAGCTCGAGGCCCGCATCCACCAGCAGCGCCTCCTGCTGGCCCGCCTGCGCGACGGCGGAGTC
GGCTTCGGCAAGGACGAGAGTGTCGCGGCTACTGCTGCCGATGTCAAGATGGAAAACATGTGA
Transcript >Hirsu2|103
ATGGCCGCCCAGCAGCAACCGCAGCAGTCGCTCGCCCTCCCGCCCACGCTCTCCCCCGACAACCTCGACACCCTG
TCCGAGCTGTCCGTCGTGCTGGCCAAGGTCCGCGCCGGCATCCAGTCGTCGACGGGCATCACCATCGCCACCGGC
GCCACGCCCGGCGGGCCCAGCACCAACGGCCAGCAGCTCTCCTTCAAGGACGTGCCCGGCGCCACCGACGGCCTC
AAGCACAAGCTGCAGCACGCCAGGGCCCAGGTCCGCCTCCTGCCGGACATGGCCAGGTCCGTCGACGACCAGCAG
CGCGAGATCGACGAGCTCGAGGCCCGCATCCACCAGCAGCGCCTCCTGCTGGCCCGCCTGCGCGACGGCGGAGTC
GGCTTCGGCAAGGACGAGAGTGTCGCGGCTACTGCTGCCGATGTCAAGATGGAAAACATGTGA
Gene >Hirsu2|103
ATGGCCGCCCAGCAGCAACCGCAGCAGTCGCTCGCCCTCCCGCCCACGCTCTCCCCCGACAACCTCGACACCCTG
TCCGAGCTGTCCGTCGTGCTGGCCAAGGTCCGCGCCGGCATCCAGTCGTCGACGGGCATCACCATCGCCACCGGC
GCCACGCCCGGCGGGCCCAGCACCAACGGCCAGCAGCTCTCCTTCAAGGACGTGCCCGGCGCCACCGACGGCCTC
AAGCACAAGCTGCAGCACGCCAGGGCCCAGGTCCGCCTCCTGCCGGACATGGCCAGGTCCGTCGACGACCAGCAG
CGCGAGATCGACGAGCTCGAGGCCCGCATCCACCAGCAGCGCCTCCTGCTGGCCCGCCTGCGCGACGGCGGAGTC
GGCTTCGGCAAGGACGAGAGTGTCGCGGCTACTGCTGCCGATGTCAAGATGGAAAACATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail